Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2476963..2477185 | Replicon | chromosome |
Accession | NZ_CP069996 | ||
Organism | Escherichia coli strain FDAARGOS_1300 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | I6K30_RS12065 | Protein ID | WP_001295224.1 |
Coordinates | 2477078..2477185 (+) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2476963..2477029 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I6K30_RS12045 | 2472835..2473818 | + | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
I6K30_RS12050 | 2473815..2474819 | + | 1005 | WP_000103579.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
I6K30_RS12055 | 2474849..2476120 | - | 1272 | WP_001332306.1 | aromatic amino acid transport family protein | - |
I6K30_RS12060 | 2476596..2476703 | + | 108 | WP_000170745.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- | 2476963..2477029 | - | 67 | - | - | Antitoxin |
I6K30_RS12065 | 2477078..2477185 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
I6K30_RS12070 | 2477561..2477668 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
I6K30_RS12075 | 2477754..2479433 | - | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
I6K30_RS12080 | 2479430..2479621 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
I6K30_RS12085 | 2479618..2481189 | - | 1572 | WP_001204957.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
I6K30_RS12090 | 2481462..2481650 | + | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T192593 WP_001295224.1 NZ_CP069996:2477078-2477185 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T192593 NZ_CP092466:3780576-3780794 [Citrobacter portucalensis]
ATGTCCGATAAACCATTAACTAAAACAGATTATTTGATGCGCCTGCGACGTTGCCAGACAATTGATACGCTAGAGCGCGT
TATTGAAAAAAATAAATATGAATTGTCCGACAACGAACTGGCTGTATTTTACTCAGCAGCAGATCATCGCCTTGCTGAAT
TGACCATGAATAAGCTTTACGACAAGATTCCAACTTCTGTTTGGAAATTCATTCGCTAA
ATGTCCGATAAACCATTAACTAAAACAGATTATTTGATGCGCCTGCGACGTTGCCAGACAATTGATACGCTAGAGCGCGT
TATTGAAAAAAATAAATATGAATTGTCCGACAACGAACTGGCTGTATTTTACTCAGCAGCAGATCATCGCCTTGCTGAAT
TGACCATGAATAAGCTTTACGACAAGATTCCAACTTCTGTTTGGAAATTCATTCGCTAA
Antitoxin
Download Length: 67 bp
>AT192593 NZ_CP069996:c2477029-2476963 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|