Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 106845..107271 | Replicon | plasmid unnamed |
Accession | NZ_CP069991 | ||
Organism | Escherichia coli strain FDAARGOS_1304 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | I6K34_RS25645 | Protein ID | WP_001372321.1 |
Coordinates | 106845..106970 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 107047..107271 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I6K34_RS25620 (102241) | 102241..102930 | - | 690 | WP_033550311.1 | conjugal transfer transcriptional regulator TraJ | - |
I6K34_RS25625 (103117) | 103117..103500 | - | 384 | WP_001151538.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
I6K34_RS25630 (103914) | 103914..104423 | + | 510 | WP_000759173.1 | transglycosylase SLT domain-containing protein | - |
I6K34_RS25635 (104720) | 104720..105541 | - | 822 | WP_001234445.1 | DUF932 domain-containing protein | - |
I6K34_RS25640 (105651) | 105651..105947 | - | 297 | WP_001272251.1 | hypothetical protein | - |
I6K34_RS26220 (106247) | 106247..106544 | + | 298 | Protein_121 | hypothetical protein | - |
I6K34_RS25645 (106845) | 106845..106970 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
I6K34_RS26225 (106912) | 106912..107061 | - | 150 | Protein_123 | plasmid maintenance protein Mok | - |
I6K34_RS25650 (107083) | 107083..107262 | + | 180 | WP_001309233.1 | hypothetical protein | - |
- (107047) | 107047..107271 | - | 225 | NuclAT_0 | - | Antitoxin |
- (107047) | 107047..107271 | - | 225 | NuclAT_0 | - | Antitoxin |
- (107047) | 107047..107271 | - | 225 | NuclAT_0 | - | Antitoxin |
- (107047) | 107047..107271 | - | 225 | NuclAT_0 | - | Antitoxin |
I6K34_RS25655 (107240) | 107240..108002 | - | 763 | Protein_125 | plasmid SOS inhibition protein A | - |
I6K34_RS25660 (107999) | 107999..108433 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
I6K34_RS25665 (108502) | 108502..110466 | - | 1965 | WP_033550309.1 | ParB/RepB/Spo0J family partition protein | - |
I6K34_RS25670 (110527) | 110527..110760 | - | 234 | WP_033550308.1 | DUF905 family protein | - |
I6K34_RS25675 (110818) | 110818..111345 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
I6K34_RS25680 (111647) | 111647..112096 | + | 450 | Protein_130 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | senB | 1..133493 | 133493 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T192535 WP_001372321.1 NZ_CP069991:c106970-106845 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T192535 NZ_CP092449:2606269-2606376 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGGACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 225 bp
>AT192535 NZ_CP069991:c107271-107047 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|