Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 64529..64782 | Replicon | plasmid unnamed |
| Accession | NZ_CP069991 | ||
| Organism | Escherichia coli strain FDAARGOS_1304 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A148HBD8 |
| Locus tag | I6K34_RS25400 | Protein ID | WP_001336447.1 |
| Coordinates | 64529..64678 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 64726..64782 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6K34_RS25360 (60004) | 60004..60774 | + | 771 | WP_000712166.1 | molybdopterin-dependent oxidoreductase | - |
| I6K34_RS25365 (60804) | 60804..61052 | + | 249 | WP_000738203.1 | hypothetical protein | - |
| I6K34_RS25370 (61202) | 61202..61300 | - | 99 | WP_137491101.1 | transposase | - |
| I6K34_RS25375 (61493) | 61493..61801 | + | 309 | Protein_67 | transposase | - |
| I6K34_RS25385 (62829) | 62829..63686 | - | 858 | WP_021534656.1 | incFII family plasmid replication initiator RepA | - |
| I6K34_RS25390 (63679) | 63679..63753 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
| I6K34_RS25395 (63987) | 63987..64244 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
| I6K34_RS25400 (64529) | 64529..64678 | - | 150 | WP_001336447.1 | Hok/Gef family protein | Toxin |
| - (64726) | 64726..64782 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (64726) | 64726..64782 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (64726) | 64726..64782 | + | 57 | NuclAT_1 | - | Antitoxin |
| - (64726) | 64726..64782 | + | 57 | NuclAT_1 | - | Antitoxin |
| I6K34_RS25405 (64877) | 64877..65314 | - | 438 | WP_000872609.1 | hypothetical protein | - |
| I6K34_RS25410 (65467) | 65467..65850 | - | 384 | WP_001109264.1 | hypothetical protein | - |
| I6K34_RS25415 (65953) | 65953..66414 | - | 462 | WP_000760080.1 | thermonuclease family protein | - |
| I6K34_RS25420 (67167) | 67167..67370 | - | 204 | WP_001336517.1 | hypothetical protein | - |
| I6K34_RS25425 (67522) | 67522..68079 | - | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
| I6K34_RS25430 (68134) | 68134..68880 | - | 747 | WP_000205709.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | senB | 1..133493 | 133493 | |
| - | flank | IS/Tn | - | - | 61535..61801 | 266 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T192531 WP_001336447.1 NZ_CP069991:c64678-64529 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T192531 NZ_CP092449:1928838-1928941 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 57 bp
>AT192531 NZ_CP069991:64726-64782 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
