192480

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4247533..4247754 Replicon chromosome
Accession NZ_CP069980
Organism Escherichia coli strain FDAARGOS_1291

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag I6K21_RS20175 Protein ID WP_000170965.1
Coordinates 4247533..4247640 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4247688..4247754 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K21_RS20150 (4243378) 4243378..4244460 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K21_RS20155 (4244460) 4244460..4245293 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K21_RS20160 (4245290) 4245290..4245682 + 393 WP_000151883.1 invasion regulator SirB2 -
I6K21_RS20165 (4245686) 4245686..4246495 + 810 WP_001257044.1 invasion regulator SirB1 -
I6K21_RS20170 (4246531) 4246531..4247385 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K21_RS20175 (4247533) 4247533..4247640 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4247690) 4247690..4247753 + 64 NuclAT_29 - -
- (4247690) 4247690..4247753 + 64 NuclAT_29 - -
- (4247690) 4247690..4247753 + 64 NuclAT_29 - -
- (4247690) 4247690..4247753 + 64 NuclAT_29 - -
- (4247690) 4247690..4247753 + 64 NuclAT_31 - -
- (4247690) 4247690..4247753 + 64 NuclAT_31 - -
- (4247690) 4247690..4247753 + 64 NuclAT_31 - -
- (4247690) 4247690..4247753 + 64 NuclAT_31 - -
- (4247690) 4247690..4247753 + 64 NuclAT_33 - -
- (4247690) 4247690..4247753 + 64 NuclAT_33 - -
- (4247690) 4247690..4247753 + 64 NuclAT_33 - -
- (4247690) 4247690..4247753 + 64 NuclAT_33 - -
- (4247690) 4247690..4247753 + 64 NuclAT_35 - -
- (4247690) 4247690..4247753 + 64 NuclAT_35 - -
- (4247690) 4247690..4247753 + 64 NuclAT_35 - -
- (4247690) 4247690..4247753 + 64 NuclAT_35 - -
- (4247690) 4247690..4247753 + 64 NuclAT_37 - -
- (4247690) 4247690..4247753 + 64 NuclAT_37 - -
- (4247690) 4247690..4247753 + 64 NuclAT_37 - -
- (4247690) 4247690..4247753 + 64 NuclAT_37 - -
- (4247690) 4247690..4247753 + 64 NuclAT_39 - -
- (4247690) 4247690..4247753 + 64 NuclAT_39 - -
- (4247690) 4247690..4247753 + 64 NuclAT_39 - -
- (4247690) 4247690..4247753 + 64 NuclAT_39 - -
- (4247688) 4247688..4247754 + 67 NuclAT_16 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_16 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_16 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_16 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_18 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_18 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_18 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_18 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_20 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_20 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_20 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_20 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_22 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_22 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_22 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_22 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_24 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_24 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_24 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_24 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_26 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_26 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_26 - Antitoxin
- (4247688) 4247688..4247754 + 67 NuclAT_26 - Antitoxin
- (4247690) 4247690..4247755 + 66 NuclAT_41 - -
- (4247690) 4247690..4247755 + 66 NuclAT_41 - -
- (4247690) 4247690..4247755 + 66 NuclAT_41 - -
- (4247690) 4247690..4247755 + 66 NuclAT_41 - -
I6K21_RS20180 (4248068) 4248068..4248175 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4248228) 4248228..4248289 + 62 NuclAT_28 - -
- (4248228) 4248228..4248289 + 62 NuclAT_28 - -
- (4248228) 4248228..4248289 + 62 NuclAT_28 - -
- (4248228) 4248228..4248289 + 62 NuclAT_28 - -
- (4248228) 4248228..4248289 + 62 NuclAT_30 - -
- (4248228) 4248228..4248289 + 62 NuclAT_30 - -
- (4248228) 4248228..4248289 + 62 NuclAT_30 - -
- (4248228) 4248228..4248289 + 62 NuclAT_30 - -
- (4248228) 4248228..4248289 + 62 NuclAT_32 - -
- (4248228) 4248228..4248289 + 62 NuclAT_32 - -
- (4248228) 4248228..4248289 + 62 NuclAT_32 - -
- (4248228) 4248228..4248289 + 62 NuclAT_32 - -
- (4248228) 4248228..4248289 + 62 NuclAT_34 - -
- (4248228) 4248228..4248289 + 62 NuclAT_34 - -
- (4248228) 4248228..4248289 + 62 NuclAT_34 - -
- (4248228) 4248228..4248289 + 62 NuclAT_34 - -
- (4248228) 4248228..4248289 + 62 NuclAT_36 - -
- (4248228) 4248228..4248289 + 62 NuclAT_36 - -
- (4248228) 4248228..4248289 + 62 NuclAT_36 - -
- (4248228) 4248228..4248289 + 62 NuclAT_36 - -
- (4248228) 4248228..4248289 + 62 NuclAT_38 - -
- (4248228) 4248228..4248289 + 62 NuclAT_38 - -
- (4248228) 4248228..4248289 + 62 NuclAT_38 - -
- (4248228) 4248228..4248289 + 62 NuclAT_38 - -
- (4248228) 4248228..4248290 + 63 NuclAT_17 - -
- (4248228) 4248228..4248290 + 63 NuclAT_17 - -
- (4248228) 4248228..4248290 + 63 NuclAT_17 - -
- (4248228) 4248228..4248290 + 63 NuclAT_17 - -
- (4248228) 4248228..4248290 + 63 NuclAT_19 - -
- (4248228) 4248228..4248290 + 63 NuclAT_19 - -
- (4248228) 4248228..4248290 + 63 NuclAT_19 - -
- (4248228) 4248228..4248290 + 63 NuclAT_19 - -
- (4248228) 4248228..4248290 + 63 NuclAT_21 - -
- (4248228) 4248228..4248290 + 63 NuclAT_21 - -
- (4248228) 4248228..4248290 + 63 NuclAT_21 - -
- (4248228) 4248228..4248290 + 63 NuclAT_21 - -
- (4248228) 4248228..4248290 + 63 NuclAT_23 - -
- (4248228) 4248228..4248290 + 63 NuclAT_23 - -
- (4248228) 4248228..4248290 + 63 NuclAT_23 - -
- (4248228) 4248228..4248290 + 63 NuclAT_23 - -
- (4248228) 4248228..4248290 + 63 NuclAT_25 - -
- (4248228) 4248228..4248290 + 63 NuclAT_25 - -
- (4248228) 4248228..4248290 + 63 NuclAT_25 - -
- (4248228) 4248228..4248290 + 63 NuclAT_25 - -
- (4248228) 4248228..4248290 + 63 NuclAT_27 - -
- (4248228) 4248228..4248290 + 63 NuclAT_27 - -
- (4248228) 4248228..4248290 + 63 NuclAT_27 - -
- (4248228) 4248228..4248290 + 63 NuclAT_27 - -
- (4248228) 4248228..4248291 + 64 NuclAT_40 - -
- (4248228) 4248228..4248291 + 64 NuclAT_40 - -
- (4248228) 4248228..4248291 + 64 NuclAT_40 - -
- (4248228) 4248228..4248291 + 64 NuclAT_40 - -
I6K21_RS20185 (4248581) 4248581..4249681 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
I6K21_RS20190 (4249951) 4249951..4250181 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K21_RS20195 (4250339) 4250339..4251034 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K21_RS20200 (4251078) 4251078..4251431 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T192480 WP_000170965.1 NZ_CP069980:c4247640-4247533 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T192480 NZ_CP069980:c4247640-4247533 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT192480 NZ_CP069980:4247688-4247754 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References