192405

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3438968..3439189 Replicon chromosome
Accession NZ_CP069973
Organism Escherichia coli strain FDAARGOS_1280

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag I6K10_RS17315 Protein ID WP_000176713.1
Coordinates 3438968..3439075 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3439123..3439189 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K10_RS17285 (3434102) 3434102..3435184 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K10_RS17290 (3435184) 3435184..3436017 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K10_RS17295 (3436014) 3436014..3436406 + 393 WP_000200377.1 invasion regulator SirB2 -
I6K10_RS17300 (3436410) 3436410..3437219 + 810 WP_001257044.1 invasion regulator SirB1 -
I6K10_RS17305 (3437255) 3437255..3438109 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K10_RS17310 (3438304) 3438304..3438762 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
I6K10_RS17315 (3438968) 3438968..3439075 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3439125) 3439125..3439188 + 64 NuclAT_46 - -
- (3439125) 3439125..3439188 + 64 NuclAT_46 - -
- (3439125) 3439125..3439188 + 64 NuclAT_46 - -
- (3439125) 3439125..3439188 + 64 NuclAT_46 - -
- (3439125) 3439125..3439188 + 64 NuclAT_48 - -
- (3439125) 3439125..3439188 + 64 NuclAT_48 - -
- (3439125) 3439125..3439188 + 64 NuclAT_48 - -
- (3439125) 3439125..3439188 + 64 NuclAT_48 - -
- (3439123) 3439123..3439189 + 67 NuclAT_21 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_21 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_21 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_21 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_26 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_26 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_26 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_26 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_31 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_31 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_31 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_31 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_36 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_36 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_36 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_36 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_38 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_38 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_38 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_38 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_43 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_43 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_43 - Antitoxin
- (3439123) 3439123..3439189 + 67 NuclAT_43 - Antitoxin
I6K10_RS17320 (3439503) 3439503..3439610 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3439663) 3439663..3439724 + 62 NuclAT_45 - -
- (3439663) 3439663..3439724 + 62 NuclAT_45 - -
- (3439663) 3439663..3439724 + 62 NuclAT_45 - -
- (3439663) 3439663..3439724 + 62 NuclAT_45 - -
- (3439663) 3439663..3439724 + 62 NuclAT_47 - -
- (3439663) 3439663..3439724 + 62 NuclAT_47 - -
- (3439663) 3439663..3439724 + 62 NuclAT_47 - -
- (3439663) 3439663..3439724 + 62 NuclAT_47 - -
- (3439663) 3439663..3439725 + 63 NuclAT_22 - -
- (3439663) 3439663..3439725 + 63 NuclAT_22 - -
- (3439663) 3439663..3439725 + 63 NuclAT_22 - -
- (3439663) 3439663..3439725 + 63 NuclAT_22 - -
- (3439663) 3439663..3439725 + 63 NuclAT_27 - -
- (3439663) 3439663..3439725 + 63 NuclAT_27 - -
- (3439663) 3439663..3439725 + 63 NuclAT_27 - -
- (3439663) 3439663..3439725 + 63 NuclAT_27 - -
- (3439663) 3439663..3439725 + 63 NuclAT_32 - -
- (3439663) 3439663..3439725 + 63 NuclAT_32 - -
- (3439663) 3439663..3439725 + 63 NuclAT_32 - -
- (3439663) 3439663..3439725 + 63 NuclAT_32 - -
- (3439663) 3439663..3439725 + 63 NuclAT_37 - -
- (3439663) 3439663..3439725 + 63 NuclAT_37 - -
- (3439663) 3439663..3439725 + 63 NuclAT_37 - -
- (3439663) 3439663..3439725 + 63 NuclAT_37 - -
- (3439663) 3439663..3439725 + 63 NuclAT_39 - -
- (3439663) 3439663..3439725 + 63 NuclAT_39 - -
- (3439663) 3439663..3439725 + 63 NuclAT_39 - -
- (3439663) 3439663..3439725 + 63 NuclAT_39 - -
- (3439663) 3439663..3439725 + 63 NuclAT_44 - -
- (3439663) 3439663..3439725 + 63 NuclAT_44 - -
- (3439663) 3439663..3439725 + 63 NuclAT_44 - -
- (3439663) 3439663..3439725 + 63 NuclAT_44 - -
I6K10_RS17325 (3440016) 3440016..3441116 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
I6K10_RS17330 (3441386) 3441386..3441616 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K10_RS17335 (3441774) 3441774..3442469 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K10_RS17340 (3442513) 3442513..3442866 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 3438304..3438762 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T192405 WP_000176713.1 NZ_CP069973:c3439075-3438968 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T192405 NZ_CP092373:c3421853-3421524 [Pantoea sp. Z09]
TTGGTAATGCAATCTGTTCCTGACGCCGGAGATATCCTCTGGCTCGATTTCACTCCTCAGGCCGGGCATGAGCAAGCTGG
CCGCAGGCCGGCGCTGGTCATGAGCCCGGCGATTTACAACCGCATTGGCATGATGGTTTGCGTTCCGCTCACCACCAGGA
TCAAAGGTAACCCGTTTGAAGTGCCCATTGCCGGCGCGCCCGCAAATGTTGCCCTGGCAGACCAGGTTCGTAACCTCGAC
TGGAAAGCGCGCAACGCGGCGCCAAAGGGCCGCGCTACTCCGCAAGAGCTTGAAGCGGTCCGCGTTAAAGCGCGCCTGCT
GATCGGCTGA

Antitoxin


Download         Length: 67 bp

>AT192405 NZ_CP069973:3439123-3439189 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References