Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 3438968..3439189 | Replicon | chromosome |
| Accession | NZ_CP069973 | ||
| Organism | Escherichia coli strain FDAARGOS_1280 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | I6K10_RS17315 | Protein ID | WP_000176713.1 |
| Coordinates | 3438968..3439075 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 3439123..3439189 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6K10_RS17285 (3434102) | 3434102..3435184 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| I6K10_RS17290 (3435184) | 3435184..3436017 | + | 834 | WP_000456570.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| I6K10_RS17295 (3436014) | 3436014..3436406 | + | 393 | WP_000200377.1 | invasion regulator SirB2 | - |
| I6K10_RS17300 (3436410) | 3436410..3437219 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| I6K10_RS17305 (3437255) | 3437255..3438109 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| I6K10_RS17310 (3438304) | 3438304..3438762 | + | 459 | WP_000526135.1 | IS200/IS605-like element IS200C family transposase | - |
| I6K10_RS17315 (3438968) | 3438968..3439075 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (3439125) | 3439125..3439188 | + | 64 | NuclAT_46 | - | - |
| - (3439125) | 3439125..3439188 | + | 64 | NuclAT_46 | - | - |
| - (3439125) | 3439125..3439188 | + | 64 | NuclAT_46 | - | - |
| - (3439125) | 3439125..3439188 | + | 64 | NuclAT_46 | - | - |
| - (3439125) | 3439125..3439188 | + | 64 | NuclAT_48 | - | - |
| - (3439125) | 3439125..3439188 | + | 64 | NuclAT_48 | - | - |
| - (3439125) | 3439125..3439188 | + | 64 | NuclAT_48 | - | - |
| - (3439125) | 3439125..3439188 | + | 64 | NuclAT_48 | - | - |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_21 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_26 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_26 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_26 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_26 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_31 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_36 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_36 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_36 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_36 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_38 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_38 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_38 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_38 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_43 | - | Antitoxin |
| - (3439123) | 3439123..3439189 | + | 67 | NuclAT_43 | - | Antitoxin |
| I6K10_RS17320 (3439503) | 3439503..3439610 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (3439663) | 3439663..3439724 | + | 62 | NuclAT_45 | - | - |
| - (3439663) | 3439663..3439724 | + | 62 | NuclAT_45 | - | - |
| - (3439663) | 3439663..3439724 | + | 62 | NuclAT_45 | - | - |
| - (3439663) | 3439663..3439724 | + | 62 | NuclAT_45 | - | - |
| - (3439663) | 3439663..3439724 | + | 62 | NuclAT_47 | - | - |
| - (3439663) | 3439663..3439724 | + | 62 | NuclAT_47 | - | - |
| - (3439663) | 3439663..3439724 | + | 62 | NuclAT_47 | - | - |
| - (3439663) | 3439663..3439724 | + | 62 | NuclAT_47 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_22 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_22 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_22 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_22 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_27 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_27 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_27 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_27 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_32 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_32 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_32 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_32 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_37 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_37 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_37 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_37 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_39 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_39 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_39 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_39 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_44 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_44 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_44 | - | - |
| - (3439663) | 3439663..3439725 | + | 63 | NuclAT_44 | - | - |
| I6K10_RS17325 (3440016) | 3440016..3441116 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| I6K10_RS17330 (3441386) | 3441386..3441616 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| I6K10_RS17335 (3441774) | 3441774..3442469 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| I6K10_RS17340 (3442513) | 3442513..3442866 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 3438304..3438762 | 458 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T192405 WP_000176713.1 NZ_CP069973:c3439075-3438968 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T192405 NZ_CP092373:c3421853-3421524 [Pantoea sp. Z09]
TTGGTAATGCAATCTGTTCCTGACGCCGGAGATATCCTCTGGCTCGATTTCACTCCTCAGGCCGGGCATGAGCAAGCTGG
CCGCAGGCCGGCGCTGGTCATGAGCCCGGCGATTTACAACCGCATTGGCATGATGGTTTGCGTTCCGCTCACCACCAGGA
TCAAAGGTAACCCGTTTGAAGTGCCCATTGCCGGCGCGCCCGCAAATGTTGCCCTGGCAGACCAGGTTCGTAACCTCGAC
TGGAAAGCGCGCAACGCGGCGCCAAAGGGCCGCGCTACTCCGCAAGAGCTTGAAGCGGTCCGCGTTAAAGCGCGCCTGCT
GATCGGCTGA
TTGGTAATGCAATCTGTTCCTGACGCCGGAGATATCCTCTGGCTCGATTTCACTCCTCAGGCCGGGCATGAGCAAGCTGG
CCGCAGGCCGGCGCTGGTCATGAGCCCGGCGATTTACAACCGCATTGGCATGATGGTTTGCGTTCCGCTCACCACCAGGA
TCAAAGGTAACCCGTTTGAAGTGCCCATTGCCGGCGCGCCCGCAAATGTTGCCCTGGCAGACCAGGTTCGTAACCTCGAC
TGGAAAGCGCGCAACGCGGCGCCAAAGGGCCGCGCTACTCCGCAAGAGCTTGAAGCGGTCCGCGTTAAAGCGCGCCTGCT
GATCGGCTGA
Antitoxin
Download Length: 67 bp
>AT192405 NZ_CP069973:3439123-3439189 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|