Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 4586561..4586780 Replicon chromosome
Accession NZ_CP069945
Organism Escherichia coli strain FDAARGOS_1373

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag I6L03_RS21785 Protein ID WP_000170738.1
Coordinates 4586561..4586668 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 4586717..4586780 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6L03_RS21760 (4582095) 4582095..4582283 - 189 WP_001063314.1 cellulose biosynthesis protein BcsR -
I6L03_RS21765 (4582556) 4582556..4584127 + 1572 WP_001204945.1 cellulose biosynthesis c-di-GMP-binding protein BcsE -
I6L03_RS21770 (4584124) 4584124..4584315 + 192 WP_000988308.1 cellulose biosynthesis protein BcsF -
I6L03_RS21775 (4584312) 4584312..4585991 + 1680 WP_000191567.1 cellulose biosynthesis protein BcsG -
I6L03_RS21780 (4586078) 4586078..4586185 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
I6L03_RS21785 (4586561) 4586561..4586668 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4586717) 4586717..4586780 + 64 NuclAT_13 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_13 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_13 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_13 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_15 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_15 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_15 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_15 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_17 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_17 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_17 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_17 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_19 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_19 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_19 - Antitoxin
- (4586717) 4586717..4586780 + 64 NuclAT_19 - Antitoxin
- (4586717) 4586717..4586782 + 66 NuclAT_11 - -
- (4586717) 4586717..4586782 + 66 NuclAT_11 - -
- (4586717) 4586717..4586782 + 66 NuclAT_11 - -
- (4586717) 4586717..4586782 + 66 NuclAT_11 - -
- (4586717) 4586717..4586782 + 66 NuclAT_9 - -
- (4586717) 4586717..4586782 + 66 NuclAT_9 - -
- (4586717) 4586717..4586782 + 66 NuclAT_9 - -
- (4586717) 4586717..4586782 + 66 NuclAT_9 - -
I6L03_RS21790 (4587044) 4587044..4587151 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4587200) 4587200..4587263 + 64 NuclAT_14 - -
- (4587200) 4587200..4587263 + 64 NuclAT_14 - -
- (4587200) 4587200..4587263 + 64 NuclAT_14 - -
- (4587200) 4587200..4587263 + 64 NuclAT_14 - -
- (4587200) 4587200..4587263 + 64 NuclAT_16 - -
- (4587200) 4587200..4587263 + 64 NuclAT_16 - -
- (4587200) 4587200..4587263 + 64 NuclAT_16 - -
- (4587200) 4587200..4587263 + 64 NuclAT_16 - -
- (4587200) 4587200..4587263 + 64 NuclAT_18 - -
- (4587200) 4587200..4587263 + 64 NuclAT_18 - -
- (4587200) 4587200..4587263 + 64 NuclAT_18 - -
- (4587200) 4587200..4587263 + 64 NuclAT_18 - -
- (4587200) 4587200..4587263 + 64 NuclAT_20 - -
- (4587200) 4587200..4587263 + 64 NuclAT_20 - -
- (4587200) 4587200..4587263 + 64 NuclAT_20 - -
- (4587200) 4587200..4587263 + 64 NuclAT_20 - -
- (4587200) 4587200..4587265 + 66 NuclAT_10 - -
- (4587200) 4587200..4587265 + 66 NuclAT_10 - -
- (4587200) 4587200..4587265 + 66 NuclAT_10 - -
- (4587200) 4587200..4587265 + 66 NuclAT_10 - -
- (4587200) 4587200..4587265 + 66 NuclAT_12 - -
- (4587200) 4587200..4587265 + 66 NuclAT_12 - -
- (4587200) 4587200..4587265 + 66 NuclAT_12 - -
- (4587200) 4587200..4587265 + 66 NuclAT_12 - -
I6L03_RS21795 (4587627) 4587627..4588898 + 1272 WP_001298005.1 aromatic amino acid transport family protein -
I6L03_RS21800 (4588928) 4588928..4589932 - 1005 WP_000103577.1 dipeptide ABC transporter ATP-binding subunit DppF -
I6L03_RS21805 (4589929) 4589929..4590912 - 984 WP_001196477.1 dipeptide ABC transporter ATP-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T192247 WP_000170738.1 NZ_CP069945:c4586668-4586561 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T192247 NZ_CP092252:3527494-3527712 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA

Antitoxin


Download         Length: 64 bp

>AT192247 NZ_CP069945:4586717-4586780 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References