Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokC/Ldr(toxin) |
| Location | 4586561..4586780 | Replicon | chromosome |
| Accession | NZ_CP069945 | ||
| Organism | Escherichia coli strain FDAARGOS_1373 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A829L523 |
| Locus tag | I6L03_RS21785 | Protein ID | WP_000170738.1 |
| Coordinates | 4586561..4586668 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 4586717..4586780 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6L03_RS21760 (4582095) | 4582095..4582283 | - | 189 | WP_001063314.1 | cellulose biosynthesis protein BcsR | - |
| I6L03_RS21765 (4582556) | 4582556..4584127 | + | 1572 | WP_001204945.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| I6L03_RS21770 (4584124) | 4584124..4584315 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| I6L03_RS21775 (4584312) | 4584312..4585991 | + | 1680 | WP_000191567.1 | cellulose biosynthesis protein BcsG | - |
| I6L03_RS21780 (4586078) | 4586078..4586185 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| I6L03_RS21785 (4586561) | 4586561..4586668 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_13 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_13 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_13 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_13 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_15 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_15 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_15 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_15 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_17 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_17 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_17 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_17 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_19 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_19 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_19 | - | Antitoxin |
| - (4586717) | 4586717..4586780 | + | 64 | NuclAT_19 | - | Antitoxin |
| - (4586717) | 4586717..4586782 | + | 66 | NuclAT_11 | - | - |
| - (4586717) | 4586717..4586782 | + | 66 | NuclAT_11 | - | - |
| - (4586717) | 4586717..4586782 | + | 66 | NuclAT_11 | - | - |
| - (4586717) | 4586717..4586782 | + | 66 | NuclAT_11 | - | - |
| - (4586717) | 4586717..4586782 | + | 66 | NuclAT_9 | - | - |
| - (4586717) | 4586717..4586782 | + | 66 | NuclAT_9 | - | - |
| - (4586717) | 4586717..4586782 | + | 66 | NuclAT_9 | - | - |
| - (4586717) | 4586717..4586782 | + | 66 | NuclAT_9 | - | - |
| I6L03_RS21790 (4587044) | 4587044..4587151 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_14 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_14 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_14 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_14 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_16 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_16 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_16 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_16 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_18 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_18 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_18 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_18 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_20 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_20 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_20 | - | - |
| - (4587200) | 4587200..4587263 | + | 64 | NuclAT_20 | - | - |
| - (4587200) | 4587200..4587265 | + | 66 | NuclAT_10 | - | - |
| - (4587200) | 4587200..4587265 | + | 66 | NuclAT_10 | - | - |
| - (4587200) | 4587200..4587265 | + | 66 | NuclAT_10 | - | - |
| - (4587200) | 4587200..4587265 | + | 66 | NuclAT_10 | - | - |
| - (4587200) | 4587200..4587265 | + | 66 | NuclAT_12 | - | - |
| - (4587200) | 4587200..4587265 | + | 66 | NuclAT_12 | - | - |
| - (4587200) | 4587200..4587265 | + | 66 | NuclAT_12 | - | - |
| - (4587200) | 4587200..4587265 | + | 66 | NuclAT_12 | - | - |
| I6L03_RS21795 (4587627) | 4587627..4588898 | + | 1272 | WP_001298005.1 | aromatic amino acid transport family protein | - |
| I6L03_RS21800 (4588928) | 4588928..4589932 | - | 1005 | WP_000103577.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| I6L03_RS21805 (4589929) | 4589929..4590912 | - | 984 | WP_001196477.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3864.67 Da Isoelectric Point: 9.0157
>T192247 WP_000170738.1 NZ_CP069945:c4586668-4586561 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK
Download Length: 108 bp
>T192247 NZ_CP092252:3527494-3527712 [Escherichia coli]
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
ATGTCCGAAAAACCTTTAACGAAAACCGATTATTTAATGCGTTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGTGT
TATCGAGAAAAATAAATACGAATTATCAGATAATGAACTGGCGGTATTTTACTCAGCCGCAGATCACCGCCTCGCCGAAT
TGACCATGAATAAACTGTACGACAAGATCCCTTCCTCAGTATGGAAATTTATTCGCTAA
Antitoxin
Download Length: 64 bp
>AT192247 NZ_CP069945:4586717-4586780 [Escherichia coli]
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGGTTCAAGATTAGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|