Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokC/Ldr(toxin) |
| Location | 929582..929803 | Replicon | chromosome |
| Accession | NZ_CP069935 | ||
| Organism | Escherichia coli strain FDAARGOS_1302 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | I6K32_RS04580 | Protein ID | WP_000170954.1 |
| Coordinates | 929582..929689 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokC | ||
| Locus tag | - | ||
| Coordinates | 929742..929803 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6K32_RS04555 (925427) | 925427..926509 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| I6K32_RS04560 (926509) | 926509..927342 | + | 834 | WP_000456474.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| I6K32_RS04565 (927339) | 927339..927731 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
| I6K32_RS04570 (927735) | 927735..928544 | + | 810 | WP_001257054.1 | invasion regulator SirB1 | - |
| I6K32_RS04575 (928580) | 928580..929434 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| I6K32_RS04580 (929582) | 929582..929689 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_14 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_14 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_14 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_14 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_15 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_16 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_16 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_16 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_16 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_17 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_17 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_17 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_17 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_18 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_19 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_19 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_19 | - | Antitoxin |
| - (929742) | 929742..929803 | + | 62 | NuclAT_19 | - | Antitoxin |
| - (929742) | 929742..929804 | + | 63 | NuclAT_10 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_10 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_10 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_10 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_11 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_11 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_11 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_11 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_12 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_12 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_12 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_12 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_13 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_13 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_13 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_13 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_8 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_8 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_8 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_8 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_9 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_9 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_9 | - | - |
| - (929742) | 929742..929804 | + | 63 | NuclAT_9 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_20 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_20 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_20 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_20 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_21 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_21 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_21 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_21 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_22 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_22 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_22 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_22 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_23 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_23 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_23 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_23 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_24 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_24 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_24 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_24 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_25 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_25 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_25 | - | - |
| - (929742) | 929742..929805 | + | 64 | NuclAT_25 | - | - |
| I6K32_RS04585 (930095) | 930095..931195 | - | 1101 | WP_001313768.1 | sodium-potassium/proton antiporter ChaA | - |
| I6K32_RS04590 (931465) | 931465..931695 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| I6K32_RS04595 (931853) | 931853..932548 | + | 696 | WP_000632706.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| I6K32_RS04600 (932592) | 932592..932945 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
| I6K32_RS04605 (933130) | 933130..934524 | + | 1395 | WP_000086194.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T192136 WP_000170954.1 NZ_CP069935:c929689-929582 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T192136 NZ_CP092077:3923773-3923991 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACCTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACCTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 62 bp
>AT192136 NZ_CP069935:929742-929803 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|