Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 929582..929803 Replicon chromosome
Accession NZ_CP069935
Organism Escherichia coli strain FDAARGOS_1302

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag I6K32_RS04580 Protein ID WP_000170954.1
Coordinates 929582..929689 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 929742..929803 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K32_RS04555 (925427) 925427..926509 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K32_RS04560 (926509) 926509..927342 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K32_RS04565 (927339) 927339..927731 + 393 WP_000200375.1 invasion regulator SirB2 -
I6K32_RS04570 (927735) 927735..928544 + 810 WP_001257054.1 invasion regulator SirB1 -
I6K32_RS04575 (928580) 928580..929434 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K32_RS04580 (929582) 929582..929689 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (929742) 929742..929803 + 62 NuclAT_14 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_14 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_14 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_14 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_15 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_15 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_15 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_15 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_16 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_16 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_16 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_16 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_17 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_17 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_17 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_17 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_18 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_18 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_18 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_18 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_19 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_19 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_19 - Antitoxin
- (929742) 929742..929803 + 62 NuclAT_19 - Antitoxin
- (929742) 929742..929804 + 63 NuclAT_10 - -
- (929742) 929742..929804 + 63 NuclAT_10 - -
- (929742) 929742..929804 + 63 NuclAT_10 - -
- (929742) 929742..929804 + 63 NuclAT_10 - -
- (929742) 929742..929804 + 63 NuclAT_11 - -
- (929742) 929742..929804 + 63 NuclAT_11 - -
- (929742) 929742..929804 + 63 NuclAT_11 - -
- (929742) 929742..929804 + 63 NuclAT_11 - -
- (929742) 929742..929804 + 63 NuclAT_12 - -
- (929742) 929742..929804 + 63 NuclAT_12 - -
- (929742) 929742..929804 + 63 NuclAT_12 - -
- (929742) 929742..929804 + 63 NuclAT_12 - -
- (929742) 929742..929804 + 63 NuclAT_13 - -
- (929742) 929742..929804 + 63 NuclAT_13 - -
- (929742) 929742..929804 + 63 NuclAT_13 - -
- (929742) 929742..929804 + 63 NuclAT_13 - -
- (929742) 929742..929804 + 63 NuclAT_8 - -
- (929742) 929742..929804 + 63 NuclAT_8 - -
- (929742) 929742..929804 + 63 NuclAT_8 - -
- (929742) 929742..929804 + 63 NuclAT_8 - -
- (929742) 929742..929804 + 63 NuclAT_9 - -
- (929742) 929742..929804 + 63 NuclAT_9 - -
- (929742) 929742..929804 + 63 NuclAT_9 - -
- (929742) 929742..929804 + 63 NuclAT_9 - -
- (929742) 929742..929805 + 64 NuclAT_20 - -
- (929742) 929742..929805 + 64 NuclAT_20 - -
- (929742) 929742..929805 + 64 NuclAT_20 - -
- (929742) 929742..929805 + 64 NuclAT_20 - -
- (929742) 929742..929805 + 64 NuclAT_21 - -
- (929742) 929742..929805 + 64 NuclAT_21 - -
- (929742) 929742..929805 + 64 NuclAT_21 - -
- (929742) 929742..929805 + 64 NuclAT_21 - -
- (929742) 929742..929805 + 64 NuclAT_22 - -
- (929742) 929742..929805 + 64 NuclAT_22 - -
- (929742) 929742..929805 + 64 NuclAT_22 - -
- (929742) 929742..929805 + 64 NuclAT_22 - -
- (929742) 929742..929805 + 64 NuclAT_23 - -
- (929742) 929742..929805 + 64 NuclAT_23 - -
- (929742) 929742..929805 + 64 NuclAT_23 - -
- (929742) 929742..929805 + 64 NuclAT_23 - -
- (929742) 929742..929805 + 64 NuclAT_24 - -
- (929742) 929742..929805 + 64 NuclAT_24 - -
- (929742) 929742..929805 + 64 NuclAT_24 - -
- (929742) 929742..929805 + 64 NuclAT_24 - -
- (929742) 929742..929805 + 64 NuclAT_25 - -
- (929742) 929742..929805 + 64 NuclAT_25 - -
- (929742) 929742..929805 + 64 NuclAT_25 - -
- (929742) 929742..929805 + 64 NuclAT_25 - -
I6K32_RS04585 (930095) 930095..931195 - 1101 WP_001313768.1 sodium-potassium/proton antiporter ChaA -
I6K32_RS04590 (931465) 931465..931695 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K32_RS04595 (931853) 931853..932548 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K32_RS04600 (932592) 932592..932945 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
I6K32_RS04605 (933130) 933130..934524 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T192136 WP_000170954.1 NZ_CP069935:c929689-929582 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T192136 NZ_CP092077:3923773-3923991 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATCCCGACCTCTGTCTGGAAATTTATCCGCTAA

Antitoxin


Download         Length: 62 bp

>AT192136 NZ_CP069935:929742-929803 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References