Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2202619..2202841 | Replicon | chromosome |
Accession | NZ_CP069893 | ||
Organism | Escherichia coli strain FDAARGOS_1286 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | S1NWX0 |
Locus tag | I6K16_RS10640 | Protein ID | WP_001295224.1 |
Coordinates | 2202619..2202726 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2202775..2202841 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I6K16_RS10615 | 2198153..2198341 | - | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
I6K16_RS10620 | 2198614..2200185 | + | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
I6K16_RS10625 | 2200182..2200373 | + | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
I6K16_RS10630 | 2200370..2202049 | + | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
I6K16_RS10635 | 2202136..2202243 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
I6K16_RS10640 | 2202619..2202726 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- | 2202775..2202841 | + | 67 | - | - | Antitoxin |
I6K16_RS10645 | 2203102..2203209 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
I6K16_RS10650 | 2203585..2203692 | - | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
I6K16_RS10655 | 2204168..2205439 | + | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
I6K16_RS10660 | 2205469..2206473 | - | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
I6K16_RS10665 | 2206470..2207453 | - | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T192079 WP_001295224.1 NZ_CP069893:c2202726-2202619 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T192079 NZ_CP092055:c2050089-2049880 [Staphylococcus aureus]
ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAAAAGAACAAGTAAGTCAATTGACAGAACGCATTTCAAA
TATGATAGGTGTTCATCAAGTGAATATTAATATAATTGATGGTCAAGTAACGGTATCGTATGAGACACCAGCAAATTTGA
ATAGTATTGAAAAAGAAATCTATGATGAAGGATACAAAATTGTATTTTAG
ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAAAAGAACAAGTAAGTCAATTGACAGAACGCATTTCAAA
TATGATAGGTGTTCATCAAGTGAATATTAATATAATTGATGGTCAAGTAACGGTATCGTATGAGACACCAGCAAATTTGA
ATAGTATTGAAAAAGAAATCTATGATGAAGGATACAAAATTGTATTTTAG
Antitoxin
Download Length: 67 bp
>AT192079 NZ_CP069893:2202775-2202841 [Escherichia coli]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|