Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 35281..35550 | Replicon | plasmid unnamed1 |
Accession | NZ_CP069883 | ||
Organism | Escherichia coli strain FDAARGOS_1289 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | I6K19_RS24940 | Protein ID | WP_001372321.1 |
Coordinates | 35425..35550 (+) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 35281..35346 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I6K19_RS24920 | 30503..32461 | + | 1959 | WP_000117179.1 | ParB/RepB/Spo0J family partition protein | - |
I6K19_RS24925 | 32516..32950 | + | 435 | WP_000845940.1 | conjugation system SOS inhibitor PsiB | - |
I6K19_RS24930 | 32947..33709 | + | 763 | Protein_40 | plasmid SOS inhibition protein A | - |
- | 33678..33779 | + | 102 | NuclAT_1 | - | - |
- | 33678..33779 | + | 102 | NuclAT_1 | - | - |
- | 33678..33779 | + | 102 | NuclAT_1 | - | - |
- | 33678..33779 | + | 102 | NuclAT_1 | - | - |
I6K19_RS24935 | 33825..35194 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
- | 35221..35348 | + | 128 | NuclAT_0 | - | - |
- | 35221..35348 | + | 128 | NuclAT_0 | - | - |
- | 35221..35348 | + | 128 | NuclAT_0 | - | - |
- | 35221..35348 | + | 128 | NuclAT_0 | - | - |
- | 35281..35346 | - | 66 | - | - | Antitoxin |
I6K19_RS27235 | 35334..35483 | + | 150 | Protein_42 | plasmid maintenance protein Mok | - |
I6K19_RS24940 | 35425..35550 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
I6K19_RS27240 | 35770..36000 | + | 231 | WP_001426396.1 | hypothetical protein | - |
I6K19_RS27245 | 35998..36171 | - | 174 | Protein_45 | hypothetical protein | - |
I6K19_RS24950 | 36241..36501 | + | 261 | WP_250187944.1 | single-stranded DNA-binding protein | - |
I6K19_RS24955 | 36595..37599 | - | 1005 | WP_204606458.1 | IS110 family transposase | - |
I6K19_RS24960 | 37850..38137 | + | 288 | WP_000107535.1 | hypothetical protein | - |
I6K19_RS24965 | 38257..39078 | + | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
I6K19_RS24970 | 39375..39965 | - | 591 | WP_277996679.1 | transglycosylase SLT domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aph(6)-Id / aph(3'')-Ib / sul2 / blaTEM-1B / dfrA8 / tet(B) | - | 1..131034 | 131034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T192030 WP_001372321.1 NZ_CP069883:35425-35550 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T192030 NZ_CP092039:4349912-4350217 [Pectobacterium brasiliense]
ATGCAATTCATTGTTTATCAATACAAACGCGCCAGTCACTACAAAATGTTTGTCGATGTGCAAAGCGATATTGTCGAGAC
ACCAAAGCGGCGTATGGTCATCCCGCTTATCGAAGCATATCACCTGTCTGAGAAAGTGAATAAAACATTGTTCCCTTTGA
TCCGCATCGACGGCGAAGATTATCGGCTGATGACAACTGAACTATCGAGCGTTCCCGTTGAGGTTATTGGTGAAGTGACT
GCGGATCTTGGCGACTACGCGGATGAGATTAAGGATGCTATTAATCTTATGTTTTGGGGGATTTGA
ATGCAATTCATTGTTTATCAATACAAACGCGCCAGTCACTACAAAATGTTTGTCGATGTGCAAAGCGATATTGTCGAGAC
ACCAAAGCGGCGTATGGTCATCCCGCTTATCGAAGCATATCACCTGTCTGAGAAAGTGAATAAAACATTGTTCCCTTTGA
TCCGCATCGACGGCGAAGATTATCGGCTGATGACAACTGAACTATCGAGCGTTCCCGTTGAGGTTATTGGTGAAGTGACT
GCGGATCTTGGCGACTACGCGGATGAGATTAAGGATGCTATTAATCTTATGTTTTGGGGGATTTGA
Antitoxin
Download Length: 66 bp
>AT192030 NZ_CP069883:c35346-35281 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|