Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4327241..4327462 Replicon chromosome
Accession NZ_CP069865
Organism Escherichia coli strain FDAARGOS_1282

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag I6K12_RS21105 Protein ID WP_000176713.1
Coordinates 4327241..4327348 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4327396..4327462 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K12_RS21075 (4322375) 4322375..4323457 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K12_RS21080 (4323457) 4323457..4324290 + 834 WP_000456570.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K12_RS21085 (4324287) 4324287..4324679 + 393 WP_000200377.1 invasion regulator SirB2 -
I6K12_RS21090 (4324683) 4324683..4325492 + 810 WP_001257044.1 invasion regulator SirB1 -
I6K12_RS21095 (4325528) 4325528..4326382 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K12_RS21100 (4326577) 4326577..4327035 + 459 WP_000526135.1 IS200/IS605-like element IS200C family transposase -
I6K12_RS21105 (4327241) 4327241..4327348 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4327398) 4327398..4327461 + 64 NuclAT_46 - -
- (4327398) 4327398..4327461 + 64 NuclAT_46 - -
- (4327398) 4327398..4327461 + 64 NuclAT_46 - -
- (4327398) 4327398..4327461 + 64 NuclAT_46 - -
- (4327398) 4327398..4327461 + 64 NuclAT_48 - -
- (4327398) 4327398..4327461 + 64 NuclAT_48 - -
- (4327398) 4327398..4327461 + 64 NuclAT_48 - -
- (4327398) 4327398..4327461 + 64 NuclAT_48 - -
- (4327396) 4327396..4327462 + 67 NuclAT_21 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_21 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_21 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_21 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_26 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_26 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_26 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_26 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_31 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_31 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_31 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_31 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_36 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_36 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_36 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_36 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_38 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_38 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_38 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_38 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_43 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_43 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_43 - Antitoxin
- (4327396) 4327396..4327462 + 67 NuclAT_43 - Antitoxin
I6K12_RS21110 (4327776) 4327776..4327883 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4327936) 4327936..4327997 + 62 NuclAT_45 - -
- (4327936) 4327936..4327997 + 62 NuclAT_45 - -
- (4327936) 4327936..4327997 + 62 NuclAT_45 - -
- (4327936) 4327936..4327997 + 62 NuclAT_45 - -
- (4327936) 4327936..4327997 + 62 NuclAT_47 - -
- (4327936) 4327936..4327997 + 62 NuclAT_47 - -
- (4327936) 4327936..4327997 + 62 NuclAT_47 - -
- (4327936) 4327936..4327997 + 62 NuclAT_47 - -
- (4327936) 4327936..4327998 + 63 NuclAT_22 - -
- (4327936) 4327936..4327998 + 63 NuclAT_22 - -
- (4327936) 4327936..4327998 + 63 NuclAT_22 - -
- (4327936) 4327936..4327998 + 63 NuclAT_22 - -
- (4327936) 4327936..4327998 + 63 NuclAT_27 - -
- (4327936) 4327936..4327998 + 63 NuclAT_27 - -
- (4327936) 4327936..4327998 + 63 NuclAT_27 - -
- (4327936) 4327936..4327998 + 63 NuclAT_27 - -
- (4327936) 4327936..4327998 + 63 NuclAT_32 - -
- (4327936) 4327936..4327998 + 63 NuclAT_32 - -
- (4327936) 4327936..4327998 + 63 NuclAT_32 - -
- (4327936) 4327936..4327998 + 63 NuclAT_32 - -
- (4327936) 4327936..4327998 + 63 NuclAT_37 - -
- (4327936) 4327936..4327998 + 63 NuclAT_37 - -
- (4327936) 4327936..4327998 + 63 NuclAT_37 - -
- (4327936) 4327936..4327998 + 63 NuclAT_37 - -
- (4327936) 4327936..4327998 + 63 NuclAT_39 - -
- (4327936) 4327936..4327998 + 63 NuclAT_39 - -
- (4327936) 4327936..4327998 + 63 NuclAT_39 - -
- (4327936) 4327936..4327998 + 63 NuclAT_39 - -
- (4327936) 4327936..4327998 + 63 NuclAT_44 - -
- (4327936) 4327936..4327998 + 63 NuclAT_44 - -
- (4327936) 4327936..4327998 + 63 NuclAT_44 - -
- (4327936) 4327936..4327998 + 63 NuclAT_44 - -
I6K12_RS21115 (4328289) 4328289..4329389 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
I6K12_RS21120 (4329659) 4329659..4329889 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K12_RS21125 (4330047) 4330047..4330742 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K12_RS21130 (4330786) 4330786..4331139 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 4326577..4327035 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T191970 WP_000176713.1 NZ_CP069865:c4327348-4327241 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T191970 NZ_CP092012:c199683-199198 [Salmonella enterica subsp. enterica serovar Kentucky]
GTGGGACATGTAACAGCACCAGAACCTTTGTCCGCTTTTCATCAGGTAGCTGAGTTCGTCAGCGGTGAAGCTGTGCTCGA
TGACTGGTTGAAGCAAAAGGGCCTCAAAAACCAGGCTCTCGGAGCGGCCAGAACATTTGTGGTGTGCAAGAAAGACACGA
AGCAAGTAGCCGGTTTTTACTCTCTGGCCACCGGTAGCGTCAACCATACAGAAGCAACAGGCAACCTTCGGCGTAACATG
CCAGATCCCATCCCTGTCATTATACTTGCCCGTCTTGCTGTCGATCTCTCATTCCATGAAAAAGGGCTTGGTGCTGATTT
ACTTCATGATGCAGTGCTTCGTTGCTATCGGGTTGCCGAGAATATTGGTGTACGTGCAATCATGGTTCATGCACTTACCG
AAGAAGCCAAAAATTTCTACATTCACCATGGTTTCAAATCATCACAAACTCAGCAGCGAACATTGTTCCTTAGGCTCCCT
CAATAG

Antitoxin


Download         Length: 67 bp

>AT191970 NZ_CP069865:4327396-4327462 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References