Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2504469..2504653 | Replicon | chromosome |
Accession | NZ_CP069799 | ||
Organism | Staphylococcus aureus strain 014S_SA |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2U0ISP5 |
Locus tag | JS513_RS12585 | Protein ID | WP_000482652.1 |
Coordinates | 2504546..2504653 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2504469..2504529 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JS513_RS12570 | 2499980..2500147 | - | 168 | Protein_2431 | hypothetical protein | - |
JS513_RS12575 | 2500378..2502111 | - | 1734 | WP_031918671.1 | ABC transporter ATP-binding protein/permease | - |
JS513_RS12580 | 2502136..2503899 | - | 1764 | WP_001064809.1 | ABC transporter ATP-binding protein/permease | - |
- | 2504469..2504529 | + | 61 | - | - | Antitoxin |
JS513_RS12585 | 2504546..2504653 | - | 108 | WP_000482652.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
JS513_RS12590 | 2504787..2505173 | - | 387 | WP_000779357.1 | flippase GtxA | - |
JS513_RS12595 | 2505441..2506583 | + | 1143 | WP_001176863.1 | glycerate kinase | - |
JS513_RS12600 | 2506643..2507302 | + | 660 | WP_000831298.1 | membrane protein | - |
JS513_RS12605 | 2507484..2508695 | + | 1212 | WP_001192075.1 | multidrug effflux MFS transporter | - |
JS513_RS12610 | 2508818..2509291 | - | 474 | WP_000456484.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4011.78 Da Isoelectric Point: 11.0582
>T191822 WP_000482652.1 NZ_CP069799:c2504653-2504546 [Staphylococcus aureus]
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLINIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T191822 NZ_CP091925:2673168-2673275 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTTGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTTGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 61 bp
>AT191822 NZ_CP069799:2504469-2504529 [Staphylococcus aureus]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|