Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 127406..127832 | Replicon | plasmid pTA13-1 |
| Accession | NZ_CP069713 | ||
| Organism | Escherichia coli strain EA13 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | JSQ77_RS23460 | Protein ID | WP_001312861.1 |
| Coordinates | 127406..127564 (-) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 127608..127832 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JSQ77_RS23425 | 122429..122656 | - | 228 | WP_000089263.1 | conjugal transfer relaxosome protein TraY | - |
| JSQ77_RS23430 | 122793..123464 | - | 672 | WP_000283561.1 | conjugal transfer transcriptional regulator TraJ | - |
| JSQ77_RS23435 | 123658..124041 | - | 384 | WP_001354030.1 | relaxosome protein TraM | - |
| JSQ77_RS23440 | 124364..124966 | + | 603 | WP_000243713.1 | transglycosylase SLT domain-containing protein | - |
| JSQ77_RS23445 | 125263..126084 | - | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
| JSQ77_RS23450 | 126195..126491 | - | 297 | WP_001272251.1 | hypothetical protein | - |
| JSQ77_RS23455 | 126791..127168 | + | 378 | Protein_151 | hypothetical protein | - |
| JSQ77_RS23460 | 127406..127564 | - | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 127608..127832 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 127608..127832 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 127608..127832 | - | 225 | NuclAT_0 | - | Antitoxin |
| - | 127608..127832 | - | 225 | NuclAT_0 | - | Antitoxin |
| JSQ77_RS23465 | 127644..127823 | + | 180 | WP_001309233.1 | hypothetical protein | - |
| JSQ77_RS23470 | 127844..128563 | - | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
| JSQ77_RS23475 | 128560..128994 | - | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
| JSQ77_RS23480 | 129063..131086 | - | 2024 | Protein_156 | ParB/RepB/Spo0J family partition protein | - |
| JSQ77_RS23485 | 131147..131380 | - | 234 | WP_000006003.1 | DUF905 family protein | - |
| JSQ77_RS23490 | 131438..131965 | - | 528 | WP_000290834.1 | single-stranded DNA-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(M) / ant(3'')-Ia / cmlA1 / aadA2 / dfrA12 / floR / sul2 / erm(42) / tet(A) / dfrA14 / mph(A) / aac(3)-IId / blaTEM-1B / sul3 / aph(3')-Ia / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..182585 | 182585 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T191767 WP_001312861.1 NZ_CP069713:c127564-127406 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T191767 NZ_CP091901:564151-564267 [Enterococcus faecalis]
ATGTTTTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTGGTTTTGCAACACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA
ATGTTTTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTGGTTTTGCAACACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA
Antitoxin
Download Length: 225 bp
>AT191767 NZ_CP069713:c127832-127608 [Escherichia coli]
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACAGATTACCCGTAAACAGCCTGAATGAGCGGGTTATTTTCAGGAAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTACCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|