Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 88000..88264 | Replicon | plasmid pECY44-2 |
Accession | NZ_CP069703 | ||
Organism | Escherichia coli strain ECY44 |
Toxin (Protein)
Gene name | pndA | Uniprot ID | U9Y6M3 |
Locus tag | JR341_RS01745 | Protein ID | WP_001331364.1 |
Coordinates | 88112..88264 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 88000..88062 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JR341_RS01730 | 83239..85530 | - | 2292 | WP_001289263.1 | hypothetical protein | - |
JR341_RS01735 | 85523..86593 | - | 1071 | WP_072645269.1 | IncI1-type conjugal transfer protein TrbB | - |
JR341_RS01740 | 86612..87820 | - | 1209 | WP_072645270.1 | IncI1-type conjugal transfer protein TrbA | - |
- | 88000..88062 | - | 63 | NuclAT_1 | - | Antitoxin |
- | 88000..88062 | - | 63 | NuclAT_1 | - | Antitoxin |
- | 88000..88062 | - | 63 | NuclAT_1 | - | Antitoxin |
- | 88000..88062 | - | 63 | NuclAT_1 | - | Antitoxin |
JR341_RS01745 | 88112..88264 | + | 153 | WP_001331364.1 | Hok/Gef family protein | Toxin |
JR341_RS01750 | 88336..88587 | - | 252 | WP_021513960.1 | hypothetical protein | - |
JR341_RS01755 | 88803..89972 | + | 1170 | WP_072645271.1 | transposase | - |
- | 90312..90363 | - | 52 | NuclAT_2 | - | - |
- | 90312..90363 | - | 52 | NuclAT_2 | - | - |
- | 90312..90363 | - | 52 | NuclAT_2 | - | - |
- | 90312..90363 | - | 52 | NuclAT_2 | - | - |
JR341_RS01760 | 91203..91379 | - | 177 | WP_001054905.1 | hypothetical protein | - |
JR341_RS01765 | 91588..91797 | - | 210 | WP_001140544.1 | hemolysin expression modulator Hha | - |
JR341_RS01770 | 91895..92557 | - | 663 | WP_072645273.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | - | - | 1..135712 | 135712 | |
- | flank | IS/Tn | - | - | 88803..89972 | 1169 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5775.13 Da Isoelectric Point: 8.7948
>T191648 WP_001331364.1 NZ_CP069703:88112-88264 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T191648 NZ_CP091872:2570772-2570951 [Bacillus sp. Man122]
ATGTCGACCTATGAATCTCTAATGGTCATGATCGGCTTTGCCAATTTAATAGGCGGGATTATGACATGGGTAATATCTCT
TTTAACATTATTATTCATGCTTAGAAAAAAAGACACTCATCCTATTTACATTACTGTAAAGGAAAAGTGTCTACACGAGG
ACCCTCCTATTAAAGGGTAG
ATGTCGACCTATGAATCTCTAATGGTCATGATCGGCTTTGCCAATTTAATAGGCGGGATTATGACATGGGTAATATCTCT
TTTAACATTATTATTCATGCTTAGAAAAAAAGACACTCATCCTATTTACATTACTGTAAAGGAAAAGTGTCTACACGAGG
ACCCTCCTATTAAAGGGTAG
Antitoxin
Download Length: 63 bp
>AT191648 NZ_CP069703:c88062-88000 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|