Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 42849..43088 | Replicon | plasmid pMUB-MIN6-1 |
| Accession | NZ_CP069693 | ||
| Organism | Escherichia coli H20 strain MIN6 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | A0A762TWR7 |
| Locus tag | JSU10_RS24215 | Protein ID | WP_023144756.1 |
| Coordinates | 42849..42983 (-) | Length | 45 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 43028..43088 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JSU10_RS24185 (38550) | 38550..39407 | - | 858 | WP_000130640.1 | incFII family plasmid replication initiator RepA | - |
| JSU10_RS24190 (39400) | 39400..39474 | - | 75 | WP_031943482.1 | RepA leader peptide Tap | - |
| JSU10_RS24200 (39836) | 39836..41377 | + | 1542 | WP_002431311.1 | IS21-like element ISEc12 family transposase | - |
| JSU10_RS24205 (41392) | 41392..42138 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| JSU10_RS24210 (42298) | 42298..42552 | - | 255 | WP_000083850.1 | replication regulatory protein RepA | - |
| JSU10_RS24215 (42849) | 42849..42983 | - | 135 | WP_023144756.1 | Hok/Gef family protein | Toxin |
| - (43028) | 43028..43088 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (43028) | 43028..43088 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (43028) | 43028..43088 | + | 61 | NuclAT_0 | - | Antitoxin |
| - (43028) | 43028..43088 | + | 61 | NuclAT_0 | - | Antitoxin |
| JSU10_RS24220 (43055) | 43055..43341 | - | 287 | Protein_60 | DUF2726 domain-containing protein | - |
| JSU10_RS24225 (43854) | 43854..44066 | - | 213 | WP_013023861.1 | hypothetical protein | - |
| JSU10_RS24235 (44914) | 44914..45297 | - | 384 | Protein_63 | DUF932 domain-containing protein | - |
| JSU10_RS24240 (45416) | 45416..45703 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JSU10_RS24245 (45728) | 45728..45934 | - | 207 | WP_000275859.1 | hypothetical protein | - |
| JSU10_RS25510 (46175) | 46175..46438 | - | 264 | WP_071781663.1 | hypothetical protein | - |
| JSU10_RS24250 (46345) | 46345..46563 | - | 219 | WP_001496291.1 | hypothetical protein | - |
| JSU10_RS24255 (46589) | 46589..47152 | - | 564 | WP_001348621.1 | class I SAM-dependent methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(3')-Ia / blaTEM-1B / dfrA1 / ant(3'')-Ia / qacE / sul1 / aph(6)-Id / aph(3'')-Ib / sul2 / tet(B) / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..89956 | 89956 | |
| - | inside | IScluster/Tn | - | - | 39836..44858 | 5022 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 45 a.a. Molecular weight: 4896.90 Da Isoelectric Point: 7.7209
>T191638 WP_023144756.1 NZ_CP069693:c42983-42849 [Escherichia coli H20]
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
MTKYTLIGLLAVCATVLCFSLIFREQLCELNIHRGNTVVQVTLA
Download Length: 135 bp
>T191638 NZ_CP091855:c1696452-1696162 [Gordonia amicalis]
ATGAGCGACGCTCCGACAGACTCGCCCGCCCCGTACCGGGTCGAGGTCGCATCCCCAGCTCGCCGCGACCTTCAACGCCT
TCCATCCCGGATCGTCCACGCCGTCATCGAATTCATCTCCGGACCTCTCGCTGGTAACCCGCACCGGCTCAGCAAGCCGC
TGCGCAACGACCTCGCCGGCCTCCACAGCGCCCGACGCGGCGACTACCGCGTCCTGCTCCGCATCGACGACCCGAACCAC
ACCATCGTTGTCGTCAGAATCGACCACCGTGCCCACGCCTATCGCACCTAA
ATGAGCGACGCTCCGACAGACTCGCCCGCCCCGTACCGGGTCGAGGTCGCATCCCCAGCTCGCCGCGACCTTCAACGCCT
TCCATCCCGGATCGTCCACGCCGTCATCGAATTCATCTCCGGACCTCTCGCTGGTAACCCGCACCGGCTCAGCAAGCCGC
TGCGCAACGACCTCGCCGGCCTCCACAGCGCCCGACGCGGCGACTACCGCGTCCTGCTCCGCATCGACGACCCGAACCAC
ACCATCGTTGTCGTCAGAATCGACCACCGTGCCCACGCCTATCGCACCTAA
Antitoxin
Download Length: 61 bp
>AT191638 NZ_CP069693:43028-43088 [Escherichia coli H20]
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAAGTGCATCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|