191035

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 484212..484433 Replicon chromosome
Accession NZ_CP069589
Organism Escherichia coli strain FDAARGOS_1266

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag I6J96_RS02590 Protein ID WP_001531632.1
Coordinates 484212..484319 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 484367..484433 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6J96_RS02565 480056..481138 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6J96_RS02570 481138..481971 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6J96_RS02575 481968..482360 + 393 WP_000200375.1 invasion regulator SirB2 -
I6J96_RS02580 482364..483173 + 810 WP_001257044.1 invasion regulator SirB1 -
I6J96_RS02585 483209..484063 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6J96_RS02590 484212..484319 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 484367..484433 + 67 NuclAT_10 - Antitoxin
- 484367..484433 + 67 NuclAT_10 - Antitoxin
- 484367..484433 + 67 NuclAT_10 - Antitoxin
- 484367..484433 + 67 NuclAT_10 - Antitoxin
- 484367..484433 + 67 NuclAT_5 - Antitoxin
- 484367..484433 + 67 NuclAT_5 - Antitoxin
- 484367..484433 + 67 NuclAT_5 - Antitoxin
- 484367..484433 + 67 NuclAT_5 - Antitoxin
- 484367..484433 + 67 NuclAT_6 - Antitoxin
- 484367..484433 + 67 NuclAT_6 - Antitoxin
- 484367..484433 + 67 NuclAT_6 - Antitoxin
- 484367..484433 + 67 NuclAT_6 - Antitoxin
- 484367..484433 + 67 NuclAT_7 - Antitoxin
- 484367..484433 + 67 NuclAT_7 - Antitoxin
- 484367..484433 + 67 NuclAT_7 - Antitoxin
- 484367..484433 + 67 NuclAT_7 - Antitoxin
- 484367..484433 + 67 NuclAT_8 - Antitoxin
- 484367..484433 + 67 NuclAT_8 - Antitoxin
- 484367..484433 + 67 NuclAT_8 - Antitoxin
- 484367..484433 + 67 NuclAT_8 - Antitoxin
- 484367..484433 + 67 NuclAT_9 - Antitoxin
- 484367..484433 + 67 NuclAT_9 - Antitoxin
- 484367..484433 + 67 NuclAT_9 - Antitoxin
- 484367..484433 + 67 NuclAT_9 - Antitoxin
- 484369..484432 + 64 NuclAT_12 - -
- 484369..484432 + 64 NuclAT_12 - -
- 484369..484432 + 64 NuclAT_12 - -
- 484369..484432 + 64 NuclAT_12 - -
- 484369..484432 + 64 NuclAT_13 - -
- 484369..484432 + 64 NuclAT_13 - -
- 484369..484432 + 64 NuclAT_13 - -
- 484369..484432 + 64 NuclAT_13 - -
- 484369..484432 + 64 NuclAT_14 - -
- 484369..484432 + 64 NuclAT_14 - -
- 484369..484432 + 64 NuclAT_14 - -
- 484369..484432 + 64 NuclAT_14 - -
- 484369..484432 + 64 NuclAT_15 - -
- 484369..484432 + 64 NuclAT_15 - -
- 484369..484432 + 64 NuclAT_15 - -
- 484369..484432 + 64 NuclAT_15 - -
- 484369..484432 + 64 NuclAT_16 - -
- 484369..484432 + 64 NuclAT_16 - -
- 484369..484432 + 64 NuclAT_16 - -
- 484369..484432 + 64 NuclAT_16 - -
- 484369..484432 + 64 NuclAT_17 - -
- 484369..484432 + 64 NuclAT_17 - -
- 484369..484432 + 64 NuclAT_17 - -
- 484369..484432 + 64 NuclAT_17 - -
- 484369..484434 + 66 NuclAT_18 - -
- 484369..484434 + 66 NuclAT_18 - -
- 484369..484434 + 66 NuclAT_18 - -
- 484369..484434 + 66 NuclAT_18 - -
- 484369..484434 + 66 NuclAT_19 - -
- 484369..484434 + 66 NuclAT_19 - -
- 484369..484434 + 66 NuclAT_19 - -
- 484369..484434 + 66 NuclAT_19 - -
- 484369..484434 + 66 NuclAT_20 - -
- 484369..484434 + 66 NuclAT_20 - -
- 484369..484434 + 66 NuclAT_20 - -
- 484369..484434 + 66 NuclAT_20 - -
- 484369..484434 + 66 NuclAT_21 - -
- 484369..484434 + 66 NuclAT_21 - -
- 484369..484434 + 66 NuclAT_21 - -
- 484369..484434 + 66 NuclAT_21 - -
- 484369..484434 + 66 NuclAT_22 - -
- 484369..484434 + 66 NuclAT_22 - -
- 484369..484434 + 66 NuclAT_22 - -
- 484369..484434 + 66 NuclAT_22 - -
- 484369..484434 + 66 NuclAT_23 - -
- 484369..484434 + 66 NuclAT_23 - -
- 484369..484434 + 66 NuclAT_23 - -
- 484369..484434 + 66 NuclAT_23 - -
I6J96_RS02595 484724..485824 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
I6J96_RS02600 486094..486333 + 240 WP_000120702.1 putative cation transport regulator ChaB -
I6J96_RS02605 486482..487177 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
I6J96_RS02610 487221..487574 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
I6J96_RS02615 487759..489153 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T191035 WP_001531632.1 NZ_CP069589:c484319-484212 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T191035 NZ_CP091622:c4012308-4012024 [Salmonella enterica]
ATGACTTATGAACTGGAATTCGACCCGAGGGCCTTAAAAGAGTGGCATAAGCTGGACGATACGGTGAAGGCTCAGCTTAA
GAAAAAGTTGGCTGATGTGCTATTGAACCCCAGAATCGACTCTGCCCGTTTAAACGGTCTTCCTGACTGCTATAAAATTA
AGCTTAAATCGTCCGGTTATCGTCTGGTGTACCAGGTTCGGGATGAAGTTGTGATTGTGTTTGTTGTTGCGGTCGGCAAG
CGAGAACATTCAGCCGTCTATCACGATGCAAACAAACGGCTTTAG

Antitoxin


Download         Length: 67 bp

>AT191035 NZ_CP069589:484367-484433 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References