Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 89158..89411 | Replicon | plasmid unnamed |
Accession | NZ_CP069439 | ||
Organism | Escherichia coli strain FDAARGOS_1260 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | A0A148HBD8 |
Locus tag | I6J90_RS24755 | Protein ID | WP_001336447.1 |
Coordinates | 89158..89307 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 89355..89411 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I6J90_RS24715 | 84236..84933 | - | 698 | Protein_92 | IS1 family transposase | - |
I6J90_RS24720 | 85182..85583 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
I6J90_RS24725 | 85516..85773 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
I6J90_RS24730 | 85866..86519 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
I6J90_RS24735 | 86617..86757 | - | 141 | WP_001333237.1 | hypothetical protein | - |
I6J90_RS24740 | 87458..88315 | - | 858 | WP_001537577.1 | incFII family plasmid replication initiator RepA | - |
I6J90_RS24745 | 88308..88382 | - | 75 | WP_001365705.1 | RepA leader peptide Tap | - |
I6J90_RS24750 | 88616..88873 | - | 258 | WP_000084404.1 | replication regulatory protein RepA | - |
I6J90_RS24755 | 89158..89307 | - | 150 | WP_001336447.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 89355..89411 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 89355..89411 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 89355..89411 | + | 57 | NuclAT_1 | - | Antitoxin |
- | 89355..89411 | + | 57 | NuclAT_1 | - | Antitoxin |
I6J90_RS24760 | 89506..89943 | - | 438 | WP_000872609.1 | hypothetical protein | - |
I6J90_RS24765 | 90096..90479 | - | 384 | WP_001109264.1 | hypothetical protein | - |
I6J90_RS24770 | 90582..91043 | - | 462 | WP_000760080.1 | thermonuclease family protein | - |
I6J90_RS24775 | 91796..91999 | - | 204 | WP_001336517.1 | hypothetical protein | - |
I6J90_RS24780 | 92151..92708 | - | 558 | WP_000139329.1 | fertility inhibition protein FinO | - |
I6J90_RS24785 | 92763..93509 | - | 747 | WP_000205709.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) | senB | 1..168315 | 168315 | |
- | flank | IS/Tn | - | - | 84236..84613 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5572.69 Da Isoelectric Point: 8.7678
>T190370 WP_001336447.1 NZ_CP069439:c89307-89158 [Escherichia coli]
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYTLIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T190370 NZ_CP091311:c1747129-1746836 [Pseudomonas juntendi]
ATGACACAAACCTTCTCTGAATTCGATCCCGCCGAATACCTCACCACTCCTGAAGCAATCGCCGTGTTCATGACTGACGC
CCTGGAGACCGGGGATGCCCGCTATGTCGCCAAAGCTGTCGGCGTAGTAGCGCGTGCCAAAGGCATGAGCGAGCTGGCAA
AAGACACAGGGCTATCTCGTGAACAGCTTTACCGGTCGTTCAGCGAGCATGGCAACCCAACCCTCAAATCGTTCCTGACC
GTGATGAAAGCATTGGGTATACACATGACAGCGCGTCCTCACATCGCAGGCTGA
ATGACACAAACCTTCTCTGAATTCGATCCCGCCGAATACCTCACCACTCCTGAAGCAATCGCCGTGTTCATGACTGACGC
CCTGGAGACCGGGGATGCCCGCTATGTCGCCAAAGCTGTCGGCGTAGTAGCGCGTGCCAAAGGCATGAGCGAGCTGGCAA
AAGACACAGGGCTATCTCGTGAACAGCTTTACCGGTCGTTCAGCGAGCATGGCAACCCAACCCTCAAATCGTTCCTGACC
GTGATGAAAGCATTGGGTATACACATGACAGCGCGTCCTCACATCGCAGGCTGA
Antitoxin
Download Length: 57 bp
>AT190370 NZ_CP069439:89355-89411 [Escherichia coli]
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
GTACTTCATGCAGGCCTCACGAGTTAATGGATTAACAAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|