Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2084197..2084418 Replicon chromosome
Accession NZ_CP068825
Organism Escherichia coli strain RIVM_C030256

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag JNN79_RS10080 Protein ID WP_000170965.1
Coordinates 2084197..2084304 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2084352..2084418 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JNN79_RS10055 2080042..2081124 + 1083 WP_000804726.1 peptide chain release factor 1 -
JNN79_RS10060 2081124..2081957 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
JNN79_RS10065 2081954..2082346 + 393 WP_000151883.1 invasion regulator SirB2 -
JNN79_RS10070 2082350..2083159 + 810 WP_001257044.1 invasion regulator SirB1 -
JNN79_RS10075 2083195..2084049 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JNN79_RS10080 2084197..2084304 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2084352..2084418 + 67 NuclAT_16 - Antitoxin
- 2084352..2084418 + 67 NuclAT_16 - Antitoxin
- 2084352..2084418 + 67 NuclAT_16 - Antitoxin
- 2084352..2084418 + 67 NuclAT_16 - Antitoxin
- 2084352..2084418 + 67 NuclAT_18 - Antitoxin
- 2084352..2084418 + 67 NuclAT_18 - Antitoxin
- 2084352..2084418 + 67 NuclAT_18 - Antitoxin
- 2084352..2084418 + 67 NuclAT_18 - Antitoxin
- 2084352..2084418 + 67 NuclAT_20 - Antitoxin
- 2084352..2084418 + 67 NuclAT_20 - Antitoxin
- 2084352..2084418 + 67 NuclAT_20 - Antitoxin
- 2084352..2084418 + 67 NuclAT_20 - Antitoxin
- 2084352..2084418 + 67 NuclAT_22 - Antitoxin
- 2084352..2084418 + 67 NuclAT_22 - Antitoxin
- 2084352..2084418 + 67 NuclAT_22 - Antitoxin
- 2084352..2084418 + 67 NuclAT_22 - Antitoxin
- 2084352..2084418 + 67 NuclAT_24 - Antitoxin
- 2084352..2084418 + 67 NuclAT_24 - Antitoxin
- 2084352..2084418 + 67 NuclAT_24 - Antitoxin
- 2084352..2084418 + 67 NuclAT_24 - Antitoxin
- 2084352..2084418 + 67 NuclAT_26 - Antitoxin
- 2084352..2084418 + 67 NuclAT_26 - Antitoxin
- 2084352..2084418 + 67 NuclAT_26 - Antitoxin
- 2084352..2084418 + 67 NuclAT_26 - Antitoxin
- 2084354..2084417 + 64 NuclAT_29 - -
- 2084354..2084417 + 64 NuclAT_29 - -
- 2084354..2084417 + 64 NuclAT_29 - -
- 2084354..2084417 + 64 NuclAT_29 - -
- 2084354..2084417 + 64 NuclAT_31 - -
- 2084354..2084417 + 64 NuclAT_31 - -
- 2084354..2084417 + 64 NuclAT_31 - -
- 2084354..2084417 + 64 NuclAT_31 - -
- 2084354..2084417 + 64 NuclAT_33 - -
- 2084354..2084417 + 64 NuclAT_33 - -
- 2084354..2084417 + 64 NuclAT_33 - -
- 2084354..2084417 + 64 NuclAT_33 - -
- 2084354..2084417 + 64 NuclAT_35 - -
- 2084354..2084417 + 64 NuclAT_35 - -
- 2084354..2084417 + 64 NuclAT_35 - -
- 2084354..2084417 + 64 NuclAT_35 - -
- 2084354..2084417 + 64 NuclAT_37 - -
- 2084354..2084417 + 64 NuclAT_37 - -
- 2084354..2084417 + 64 NuclAT_37 - -
- 2084354..2084417 + 64 NuclAT_37 - -
- 2084354..2084417 + 64 NuclAT_39 - -
- 2084354..2084417 + 64 NuclAT_39 - -
- 2084354..2084417 + 64 NuclAT_39 - -
- 2084354..2084417 + 64 NuclAT_39 - -
- 2084354..2084419 + 66 NuclAT_41 - -
- 2084354..2084419 + 66 NuclAT_41 - -
- 2084354..2084419 + 66 NuclAT_41 - -
- 2084354..2084419 + 66 NuclAT_41 - -
JNN79_RS10085 2084732..2084839 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2084892..2084953 + 62 NuclAT_28 - -
- 2084892..2084953 + 62 NuclAT_28 - -
- 2084892..2084953 + 62 NuclAT_28 - -
- 2084892..2084953 + 62 NuclAT_28 - -
- 2084892..2084953 + 62 NuclAT_30 - -
- 2084892..2084953 + 62 NuclAT_30 - -
- 2084892..2084953 + 62 NuclAT_30 - -
- 2084892..2084953 + 62 NuclAT_30 - -
- 2084892..2084953 + 62 NuclAT_32 - -
- 2084892..2084953 + 62 NuclAT_32 - -
- 2084892..2084953 + 62 NuclAT_32 - -
- 2084892..2084953 + 62 NuclAT_32 - -
- 2084892..2084953 + 62 NuclAT_34 - -
- 2084892..2084953 + 62 NuclAT_34 - -
- 2084892..2084953 + 62 NuclAT_34 - -
- 2084892..2084953 + 62 NuclAT_34 - -
- 2084892..2084953 + 62 NuclAT_36 - -
- 2084892..2084953 + 62 NuclAT_36 - -
- 2084892..2084953 + 62 NuclAT_36 - -
- 2084892..2084953 + 62 NuclAT_36 - -
- 2084892..2084953 + 62 NuclAT_38 - -
- 2084892..2084953 + 62 NuclAT_38 - -
- 2084892..2084953 + 62 NuclAT_38 - -
- 2084892..2084953 + 62 NuclAT_38 - -
- 2084892..2084954 + 63 NuclAT_17 - -
- 2084892..2084954 + 63 NuclAT_17 - -
- 2084892..2084954 + 63 NuclAT_17 - -
- 2084892..2084954 + 63 NuclAT_17 - -
- 2084892..2084954 + 63 NuclAT_19 - -
- 2084892..2084954 + 63 NuclAT_19 - -
- 2084892..2084954 + 63 NuclAT_19 - -
- 2084892..2084954 + 63 NuclAT_19 - -
- 2084892..2084954 + 63 NuclAT_21 - -
- 2084892..2084954 + 63 NuclAT_21 - -
- 2084892..2084954 + 63 NuclAT_21 - -
- 2084892..2084954 + 63 NuclAT_21 - -
- 2084892..2084954 + 63 NuclAT_23 - -
- 2084892..2084954 + 63 NuclAT_23 - -
- 2084892..2084954 + 63 NuclAT_23 - -
- 2084892..2084954 + 63 NuclAT_23 - -
- 2084892..2084954 + 63 NuclAT_25 - -
- 2084892..2084954 + 63 NuclAT_25 - -
- 2084892..2084954 + 63 NuclAT_25 - -
- 2084892..2084954 + 63 NuclAT_25 - -
- 2084892..2084954 + 63 NuclAT_27 - -
- 2084892..2084954 + 63 NuclAT_27 - -
- 2084892..2084954 + 63 NuclAT_27 - -
- 2084892..2084954 + 63 NuclAT_27 - -
- 2084892..2084955 + 64 NuclAT_40 - -
- 2084892..2084955 + 64 NuclAT_40 - -
- 2084892..2084955 + 64 NuclAT_40 - -
- 2084892..2084955 + 64 NuclAT_40 - -
JNN79_RS10090 2085245..2086345 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
JNN79_RS10095 2086615..2086845 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JNN79_RS10100 2087003..2087698 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
JNN79_RS10105 2087742..2088095 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T188618 WP_000170965.1 NZ_CP068825:c2084304-2084197 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T188618 NZ_CP090514:457466-457747 [Xylella fastidiosa subsp. fastidiosa]
ATGATCAAAAGTTTCCGCCACAAAGGCATTCAACAATTCTTCCTCAAGGGATCAACCGCTGGTATCCAAACCAAACACGC
CGCCAAACTGCGTATCCAGCTCACCGCGTTGGAGAGTGCCAAGCGCCCCGAAGATATGAATGCTCCAGGCTGGAAACTGC
ACCCACTAAAAGGCGCTGACTTAAAAGGTCATTGGTCCATCTGGGTGAATGGCAACTATCGCCTCACGTTTGCTTTTGAA
GGCGAAGACGCAATCTTGGTCGACTATCAGGATTATCACTAG

Antitoxin


Download         Length: 67 bp

>AT188618 NZ_CP068825:2084352-2084418 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References