Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2084197..2084418 | Replicon | chromosome |
| Accession | NZ_CP068825 | ||
| Organism | Escherichia coli strain RIVM_C030256 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | JNN79_RS10080 | Protein ID | WP_000170965.1 |
| Coordinates | 2084197..2084304 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2084352..2084418 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JNN79_RS10055 | 2080042..2081124 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| JNN79_RS10060 | 2081124..2081957 | + | 834 | WP_000456458.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| JNN79_RS10065 | 2081954..2082346 | + | 393 | WP_000151883.1 | invasion regulator SirB2 | - |
| JNN79_RS10070 | 2082350..2083159 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| JNN79_RS10075 | 2083195..2084049 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| JNN79_RS10080 | 2084197..2084304 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2084352..2084418 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2084352..2084418 | + | 67 | NuclAT_26 | - | Antitoxin |
| - | 2084354..2084417 | + | 64 | NuclAT_29 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_29 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_29 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_29 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_31 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_31 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_31 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_31 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_33 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_33 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_33 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_33 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_35 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_35 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_35 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_35 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_37 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_37 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_37 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_37 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_39 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_39 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_39 | - | - |
| - | 2084354..2084417 | + | 64 | NuclAT_39 | - | - |
| - | 2084354..2084419 | + | 66 | NuclAT_41 | - | - |
| - | 2084354..2084419 | + | 66 | NuclAT_41 | - | - |
| - | 2084354..2084419 | + | 66 | NuclAT_41 | - | - |
| - | 2084354..2084419 | + | 66 | NuclAT_41 | - | - |
| JNN79_RS10085 | 2084732..2084839 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 2084892..2084953 | + | 62 | NuclAT_28 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_28 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_28 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_28 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_30 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_30 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_30 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_30 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_32 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_32 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_32 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_32 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_34 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_34 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_34 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_34 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_36 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_36 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_36 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_36 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_38 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_38 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_38 | - | - |
| - | 2084892..2084953 | + | 62 | NuclAT_38 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_17 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_17 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_17 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_17 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_19 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_19 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_19 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_19 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_21 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_21 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_21 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_21 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_23 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_23 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_23 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_23 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_25 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_25 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_25 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_25 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_27 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_27 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_27 | - | - |
| - | 2084892..2084954 | + | 63 | NuclAT_27 | - | - |
| - | 2084892..2084955 | + | 64 | NuclAT_40 | - | - |
| - | 2084892..2084955 | + | 64 | NuclAT_40 | - | - |
| - | 2084892..2084955 | + | 64 | NuclAT_40 | - | - |
| - | 2084892..2084955 | + | 64 | NuclAT_40 | - | - |
| JNN79_RS10090 | 2085245..2086345 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| JNN79_RS10095 | 2086615..2086845 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| JNN79_RS10100 | 2087003..2087698 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| JNN79_RS10105 | 2087742..2088095 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T188618 WP_000170965.1 NZ_CP068825:c2084304-2084197 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T188618 NZ_CP090514:457466-457747 [Xylella fastidiosa subsp. fastidiosa]
ATGATCAAAAGTTTCCGCCACAAAGGCATTCAACAATTCTTCCTCAAGGGATCAACCGCTGGTATCCAAACCAAACACGC
CGCCAAACTGCGTATCCAGCTCACCGCGTTGGAGAGTGCCAAGCGCCCCGAAGATATGAATGCTCCAGGCTGGAAACTGC
ACCCACTAAAAGGCGCTGACTTAAAAGGTCATTGGTCCATCTGGGTGAATGGCAACTATCGCCTCACGTTTGCTTTTGAA
GGCGAAGACGCAATCTTGGTCGACTATCAGGATTATCACTAG
ATGATCAAAAGTTTCCGCCACAAAGGCATTCAACAATTCTTCCTCAAGGGATCAACCGCTGGTATCCAAACCAAACACGC
CGCCAAACTGCGTATCCAGCTCACCGCGTTGGAGAGTGCCAAGCGCCCCGAAGATATGAATGCTCCAGGCTGGAAACTGC
ACCCACTAAAAGGCGCTGACTTAAAAGGTCATTGGTCCATCTGGGTGAATGGCAACTATCGCCTCACGTTTGCTTTTGAA
GGCGAAGACGCAATCTTGGTCGACTATCAGGATTATCACTAG
Antitoxin
Download Length: 67 bp
>AT188618 NZ_CP068825:2084352-2084418 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|