Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2192061..2192281 Replicon chromosome
Accession NZ_CP068823
Organism Escherichia coli strain RIVM_C029494

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag JNN66_RS10290 Protein ID WP_000170954.1
Coordinates 2192061..2192168 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2192218..2192281 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JNN66_RS10265 2187905..2188987 + 1083 WP_000804726.1 peptide chain release factor 1 -
JNN66_RS10270 2188987..2189820 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
JNN66_RS10275 2189817..2190209 + 393 WP_000200374.1 invasion regulator SirB2 -
JNN66_RS10280 2190213..2191022 + 810 WP_001257044.1 invasion regulator SirB1 -
JNN66_RS10285 2191058..2191912 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JNN66_RS10290 2192061..2192168 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2192218..2192281 + 64 NuclAT_42 - Antitoxin
- 2192218..2192281 + 64 NuclAT_42 - Antitoxin
- 2192218..2192281 + 64 NuclAT_42 - Antitoxin
- 2192218..2192281 + 64 NuclAT_42 - Antitoxin
- 2192218..2192281 + 64 NuclAT_44 - Antitoxin
- 2192218..2192281 + 64 NuclAT_44 - Antitoxin
- 2192218..2192281 + 64 NuclAT_44 - Antitoxin
- 2192218..2192281 + 64 NuclAT_44 - Antitoxin
- 2192218..2192281 + 64 NuclAT_46 - Antitoxin
- 2192218..2192281 + 64 NuclAT_46 - Antitoxin
- 2192218..2192281 + 64 NuclAT_46 - Antitoxin
- 2192218..2192281 + 64 NuclAT_46 - Antitoxin
- 2192218..2192281 + 64 NuclAT_48 - Antitoxin
- 2192218..2192281 + 64 NuclAT_48 - Antitoxin
- 2192218..2192281 + 64 NuclAT_48 - Antitoxin
- 2192218..2192281 + 64 NuclAT_48 - Antitoxin
- 2192218..2192281 + 64 NuclAT_50 - Antitoxin
- 2192218..2192281 + 64 NuclAT_50 - Antitoxin
- 2192218..2192281 + 64 NuclAT_50 - Antitoxin
- 2192218..2192281 + 64 NuclAT_50 - Antitoxin
JNN66_RS10295 2192635..2192733 - 99 WP_148713294.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2192781..2192846 + 66 NuclAT_41 - -
- 2192781..2192846 + 66 NuclAT_41 - -
- 2192781..2192846 + 66 NuclAT_41 - -
- 2192781..2192846 + 66 NuclAT_41 - -
- 2192781..2192846 + 66 NuclAT_43 - -
- 2192781..2192846 + 66 NuclAT_43 - -
- 2192781..2192846 + 66 NuclAT_43 - -
- 2192781..2192846 + 66 NuclAT_43 - -
- 2192781..2192846 + 66 NuclAT_45 - -
- 2192781..2192846 + 66 NuclAT_45 - -
- 2192781..2192846 + 66 NuclAT_45 - -
- 2192781..2192846 + 66 NuclAT_45 - -
- 2192781..2192846 + 66 NuclAT_47 - -
- 2192781..2192846 + 66 NuclAT_47 - -
- 2192781..2192846 + 66 NuclAT_47 - -
- 2192781..2192846 + 66 NuclAT_47 - -
- 2192781..2192846 + 66 NuclAT_49 - -
- 2192781..2192846 + 66 NuclAT_49 - -
- 2192781..2192846 + 66 NuclAT_49 - -
- 2192781..2192846 + 66 NuclAT_49 - -
- 2192781..2192848 + 68 NuclAT_11 - -
- 2192781..2192848 + 68 NuclAT_11 - -
- 2192781..2192848 + 68 NuclAT_11 - -
- 2192781..2192848 + 68 NuclAT_11 - -
- 2192781..2192848 + 68 NuclAT_12 - -
- 2192781..2192848 + 68 NuclAT_12 - -
- 2192781..2192848 + 68 NuclAT_12 - -
- 2192781..2192848 + 68 NuclAT_12 - -
- 2192781..2192848 + 68 NuclAT_13 - -
- 2192781..2192848 + 68 NuclAT_13 - -
- 2192781..2192848 + 68 NuclAT_13 - -
- 2192781..2192848 + 68 NuclAT_13 - -
- 2192781..2192848 + 68 NuclAT_14 - -
- 2192781..2192848 + 68 NuclAT_14 - -
- 2192781..2192848 + 68 NuclAT_14 - -
- 2192781..2192848 + 68 NuclAT_14 - -
- 2192781..2192848 + 68 NuclAT_15 - -
- 2192781..2192848 + 68 NuclAT_15 - -
- 2192781..2192848 + 68 NuclAT_15 - -
- 2192781..2192848 + 68 NuclAT_15 - -
- 2192781..2192848 + 68 NuclAT_16 - -
- 2192781..2192848 + 68 NuclAT_16 - -
- 2192781..2192848 + 68 NuclAT_16 - -
- 2192781..2192848 + 68 NuclAT_16 - -
JNN66_RS10300 2193138..2194238 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
JNN66_RS10305 2194508..2194738 + 231 WP_001146442.1 putative cation transport regulator ChaB -
JNN66_RS10310 2194896..2195591 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
JNN66_RS10315 2195635..2195988 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T188554 WP_000170954.1 NZ_CP068823:c2192168-2192061 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T188554 NZ_CP090506:c534126-533830 [Xylella fastidiosa subsp. morus]
ATGATTGAATTGAAGCAGACTGACACCTTCCGCAAGTGGCGGGAGAAACTCAAGGATGCGCGCGCCCGCTCAGCCATCGC
CTCGCGCCTCGACCGCTTGGCGTTCGGCCATGTCGGCGACGCCGAGCCAGTAGGGAAAGGTGTCAGCGAGCTTCGCATCA
ACTACGGCCCCGGTTACCGGGTGTATTTCCAGCGGCGTGGCGACACGATCTACTTGCTGCTTTGCGGCGGTGACAAAGGA
TCACAAGCGCGCGACATCAAGACTGCGCTGCACCTGTCTGAACAATGGAGCGAATGA

Antitoxin


Download         Length: 64 bp

>AT188554 NZ_CP068823:2192218-2192281 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References