Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2192061..2192281 | Replicon | chromosome |
| Accession | NZ_CP068823 | ||
| Organism | Escherichia coli strain RIVM_C029494 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | JNN66_RS10290 | Protein ID | WP_000170954.1 |
| Coordinates | 2192061..2192168 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2192218..2192281 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JNN66_RS10265 | 2187905..2188987 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| JNN66_RS10270 | 2188987..2189820 | + | 834 | WP_000456458.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| JNN66_RS10275 | 2189817..2190209 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| JNN66_RS10280 | 2190213..2191022 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| JNN66_RS10285 | 2191058..2191912 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| JNN66_RS10290 | 2192061..2192168 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2192218..2192281 | + | 64 | NuclAT_42 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_42 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_42 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_42 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_44 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_44 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_44 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_44 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_46 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_46 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_46 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_46 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_48 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_48 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_48 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_48 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_50 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_50 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_50 | - | Antitoxin |
| - | 2192218..2192281 | + | 64 | NuclAT_50 | - | Antitoxin |
| JNN66_RS10295 | 2192635..2192733 | - | 99 | WP_148713294.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2192781..2192846 | + | 66 | NuclAT_41 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_41 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_41 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_41 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_43 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_43 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_43 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_43 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_45 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_45 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_45 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_45 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_47 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_47 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_47 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_47 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_49 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_49 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_49 | - | - |
| - | 2192781..2192846 | + | 66 | NuclAT_49 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_11 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_11 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_11 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_11 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_12 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_12 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_12 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_12 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_13 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_13 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_13 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_13 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_14 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_14 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_14 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_14 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_15 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_15 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_15 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_15 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_16 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_16 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_16 | - | - |
| - | 2192781..2192848 | + | 68 | NuclAT_16 | - | - |
| JNN66_RS10300 | 2193138..2194238 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| JNN66_RS10305 | 2194508..2194738 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| JNN66_RS10310 | 2194896..2195591 | + | 696 | WP_012311798.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| JNN66_RS10315 | 2195635..2195988 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T188554 WP_000170954.1 NZ_CP068823:c2192168-2192061 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T188554 NZ_CP090506:c534126-533830 [Xylella fastidiosa subsp. morus]
ATGATTGAATTGAAGCAGACTGACACCTTCCGCAAGTGGCGGGAGAAACTCAAGGATGCGCGCGCCCGCTCAGCCATCGC
CTCGCGCCTCGACCGCTTGGCGTTCGGCCATGTCGGCGACGCCGAGCCAGTAGGGAAAGGTGTCAGCGAGCTTCGCATCA
ACTACGGCCCCGGTTACCGGGTGTATTTCCAGCGGCGTGGCGACACGATCTACTTGCTGCTTTGCGGCGGTGACAAAGGA
TCACAAGCGCGCGACATCAAGACTGCGCTGCACCTGTCTGAACAATGGAGCGAATGA
ATGATTGAATTGAAGCAGACTGACACCTTCCGCAAGTGGCGGGAGAAACTCAAGGATGCGCGCGCCCGCTCAGCCATCGC
CTCGCGCCTCGACCGCTTGGCGTTCGGCCATGTCGGCGACGCCGAGCCAGTAGGGAAAGGTGTCAGCGAGCTTCGCATCA
ACTACGGCCCCGGTTACCGGGTGTATTTCCAGCGGCGTGGCGACACGATCTACTTGCTGCTTTGCGGCGGTGACAAAGGA
TCACAAGCGCGCGACATCAAGACTGCGCTGCACCTGTCTGAACAATGGAGCGAATGA
Antitoxin
Download Length: 64 bp
>AT188554 NZ_CP068823:2192218-2192281 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|