Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symER/SymE(toxin) |
Location | 4341918..4342330 | Replicon | chromosome |
Accession | NZ_CP068816 | ||
Organism | Escherichia coli strain RIVM_C028724 |
Toxin (Protein)
Gene name | symE | Uniprot ID | S1NWQ7 |
Locus tag | JNN36_RS20800 | Protein ID | WP_000132614.1 |
Coordinates | 4341989..4342330 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | symR | ||
Locus tag | - | ||
Coordinates | 4341918..4341994 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JNN36_RS20790 | 4338593..4340062 | + | 1470 | WP_001540814.1 | type I restriction-modification system subunit M | - |
JNN36_RS20795 | 4340062..4341768 | + | 1707 | WP_001100194.1 | restriction endonuclease subunit S | - |
- | 4341918..4341994 | - | 77 | NuclAT_6 | - | Antitoxin |
- | 4341918..4341994 | - | 77 | NuclAT_6 | - | Antitoxin |
- | 4341918..4341994 | - | 77 | NuclAT_6 | - | Antitoxin |
- | 4341918..4341994 | - | 77 | NuclAT_6 | - | Antitoxin |
- | 4341918..4341994 | - | 77 | NuclAT_7 | - | Antitoxin |
- | 4341918..4341994 | - | 77 | NuclAT_7 | - | Antitoxin |
- | 4341918..4341994 | - | 77 | NuclAT_7 | - | Antitoxin |
- | 4341918..4341994 | - | 77 | NuclAT_7 | - | Antitoxin |
JNN36_RS20800 | 4341989..4342330 | + | 342 | WP_000132614.1 | endoribonuclease SymE | Toxin |
JNN36_RS20805 | 4342377..4344470 | - | 2094 | WP_000648237.1 | DUF262 domain-containing protein | - |
JNN36_RS20810 | 4344568..4344648 | - | 81 | WP_020233658.1 | hypothetical protein | - |
JNN36_RS20815 | 4344876..4345796 | - | 921 | WP_000181195.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
JNN36_RS20820 | 4345981..4347261 | + | 1281 | WP_001298033.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | cheD | 4325797..4344533 | 18736 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12266.07 Da Isoelectric Point: 8.4982
>T188347 WP_000132614.1 NZ_CP068816:4341989-4342330 [Escherichia coli]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTAVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
>T188347 NZ_CP090402:2652278-2652385 [Shigella sp. PIB]
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCACGCAGTTTGCCATGACTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 77 bp
>AT188347 NZ_CP068816:c4341994-4341918 [Escherichia coli]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|