Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4243798..4244056 | Replicon | chromosome |
Accession | NZ_CP068815 | ||
Organism | Escherichia coli strain RIVM_C028620 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | JNN49_RS20260 | Protein ID | WP_000809168.1 |
Coordinates | 4243904..4244056 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4243798..4243855 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JNN49_RS20245 | 4239627..4240886 | - | 1260 | WP_000494927.1 | hypothetical protein | - |
JNN49_RS20250 | 4241015..4242508 | - | 1494 | WP_001314416.1 | sulfatase-like hydrolase/transferase | - |
JNN49_RS20255 | 4242528..4243289 | - | 762 | WP_001274828.1 | hypothetical protein | - |
- | 4243798..4243855 | - | 58 | - | - | Antitoxin |
JNN49_RS20260 | 4243904..4244056 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
JNN49_RS20265 | 4244161..4245291 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
JNN49_RS20270 | 4245380..4247296 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
JNN49_RS20275 | 4247668..4248072 | + | 405 | WP_000843689.1 | DUF2541 family protein | - |
JNN49_RS20280 | 4248098..4248811 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T188311 WP_000809168.1 NZ_CP068815:4243904-4244056 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T188311 NZ_CP090398:2040729-2040831 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT188311 NZ_CP068815:c4243855-4243798 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|