Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 4215332..4215590 | Replicon | chromosome |
Accession | NZ_CP068809 | ||
Organism | Escherichia coli strain RIVM_C028497 |
Toxin (Protein)
Gene name | hokC | Uniprot ID | S1NX00 |
Locus tag | JNN39_RS20110 | Protein ID | WP_000809168.1 |
Coordinates | 4215438..4215590 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokC | ||
Locus tag | - | ||
Coordinates | 4215332..4215389 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JNN39_RS20095 | 4211161..4212420 | - | 1260 | WP_000494927.1 | hypothetical protein | - |
JNN39_RS20100 | 4212549..4214042 | - | 1494 | WP_001314416.1 | sulfatase-like hydrolase/transferase | - |
JNN39_RS20105 | 4214062..4214823 | - | 762 | WP_001274828.1 | hypothetical protein | - |
- | 4215332..4215389 | - | 58 | - | - | Antitoxin |
JNN39_RS20110 | 4215438..4215590 | + | 153 | WP_000809168.1 | type I toxin-antitoxin system toxin MokC | Toxin |
JNN39_RS20115 | 4215695..4216825 | - | 1131 | WP_001118464.1 | molecular chaperone DnaJ | - |
JNN39_RS20120 | 4216914..4218830 | - | 1917 | WP_000516135.1 | molecular chaperone DnaK | - |
JNN39_RS20125 | 4219202..4219606 | + | 405 | WP_000843689.1 | DUF2541 family protein | - |
JNN39_RS20130 | 4219632..4220345 | + | 714 | WP_001102393.1 | acidic protein MsyB | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5501.57 Da Isoelectric Point: 7.1312
>T188121 WP_000809168.1 NZ_CP068809:4215438-4215590 [Escherichia coli]
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
MKQHKAMIVALIVICITAVVAALVTRKDLCEVHIRTGQTEVAVFTAYESE
Download Length: 153 bp
>T188121 NZ_CP090304:c1968153-1968050 [Salmonella enterica subsp. enterica serovar Typhimurium]
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
GGCAAGGCGATTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT188121 NZ_CP068809:c4215389-4215332 [Escherichia coli]
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
GTTCTGCATATAGGGGGCCTCGGGTTGATGGTAAAATATCACTCGGGGCTTTTCTCTA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|