Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 2770206..2770356 | Replicon | chromosome |
Accession | NZ_CP068712 | ||
Organism | Staphylococcus pseudoxylosus strain 14AME19 |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | JMB28_RS13175 | Protein ID | WP_107549122.1 |
Coordinates | 2770261..2770356 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 2770206..2770235 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JMB28_RS13150 | 2765327..2765770 | - | 444 | WP_039069444.1 | tripartite tricarboxylate transporter TctB family protein | - |
JMB28_RS13155 | 2765783..2766763 | - | 981 | WP_069792613.1 | tripartite tricarboxylate transporter substrate binding protein | - |
JMB28_RS13160 | 2767098..2768153 | + | 1056 | WP_202847874.1 | DUF418 domain-containing protein | - |
JMB28_RS13165 | 2768468..2769208 | - | 741 | WP_039069452.1 | SDR family oxidoreductase | - |
JMB28_RS13170 | 2769557..2770066 | + | 510 | WP_039069453.1 | hypothetical protein | - |
- | 2770206..2770235 | - | 30 | - | - | Antitoxin |
JMB28_RS13175 | 2770261..2770356 | - | 96 | WP_107549122.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
JMB28_RS13180 | 2770619..2771794 | - | 1176 | WP_069792615.1 | ABC transporter permease | - |
JMB28_RS13185 | 2771791..2772471 | - | 681 | WP_069792616.1 | ABC transporter ATP-binding protein | - |
JMB28_RS13190 | 2772468..2773583 | - | 1116 | WP_069792617.1 | RND transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3618.37 Da Isoelectric Point: 9.1070
>T187666 WP_107549122.1 NZ_CP068712:c2770356-2770261 [Staphylococcus pseudoxylosus]
MLMIFVHIIAPVISDCAVAYFTYWLSSKRNK
MLMIFVHIIAPVISDCAVAYFTYWLSSKRNK
Download Length: 96 bp
>T187666 NZ_CP089940:2499470-2499559 [Erwinia tracheiphila]
AAGCCTGCATTAATGCCAACTTTTAGCGCATGGCTCTGAACAGAGCCATTTCCCTGGACTGAAGACAGGAGTTGTCTTCA
GTCTTTTTTT
AAGCCTGCATTAATGCCAACTTTTAGCGCATGGCTCTGAACAGAGCCATTTCCCTGGACTGAAGACAGGAGTTGTCTTCA
GTCTTTTTTT
Antitoxin
Download Length: 30 bp
>AT187666 NZ_CP068712:c2770235-2770206 [Staphylococcus pseudoxylosus]
AATCCCCTCACTATTTGCGGTAGTGAGGGG
AATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|