Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprG-sprF/- |
Location | 1055563..1055842 | Replicon | chromosome |
Accession | NZ_CP068682 | ||
Organism | Staphylococcus aureus strain NCCP11854 |
Toxin (Protein)
Gene name | SprG3 | Uniprot ID | Q2FWA7 |
Locus tag | JKV48_RS05135 | Protein ID | WP_001802298.1 |
Coordinates | 1055563..1055667 (+) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 1055663..1055842 (-) |
Genomic Context
Location: 1050957..1051739 (783 bp)
Type: Others
Protein ID: WP_235103128.1
Type: Others
Protein ID: WP_235103128.1
Location: 1051807..1052664 (858 bp)
Type: Others
Protein ID: WP_000370919.1
Type: Others
Protein ID: WP_000370919.1
Location: 1053740..1054876 (1137 bp)
Type: Others
Protein ID: Protein_1012
Type: Others
Protein ID: Protein_1012
Location: 1054919..1055402 (484 bp)
Type: Others
Protein ID: Protein_1013
Type: Others
Protein ID: Protein_1013
Location: 1055563..1055667 (105 bp)
Type: Toxin
Protein ID: WP_001802298.1
Type: Toxin
Protein ID: WP_001802298.1
Location: 1058924..1059589 (666 bp)
Type: Others
Protein ID: WP_001024088.1
Type: Others
Protein ID: WP_001024088.1
Location: 1052858..1053072 (215 bp)
Type: Others
Protein ID: Protein_1010
Type: Others
Protein ID: Protein_1010
Location: 1053359..1053451 (93 bp)
Type: Others
Protein ID: WP_031844941.1
Type: Others
Protein ID: WP_031844941.1
Location: 1055663..1055842 (180 bp)
Type: Antitoxin
Protein ID: -
Type: Antitoxin
Protein ID: -
Location: 1056116..1057207 (1092 bp)
Type: Others
Protein ID: WP_000495695.1
Type: Others
Protein ID: WP_000495695.1
Location: 1057473..1058450 (978 bp)
Type: Others
Protein ID: WP_000019732.1
Type: Others
Protein ID: WP_000019732.1
Location: 1058452..1058772 (321 bp)
Type: Others
Protein ID: WP_000139802.1
Type: Others
Protein ID: WP_000139802.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JKV48_RS05105 (JKV48_05080) | 1050957..1051739 | + | 783 | WP_235103128.1 | ABC transporter ATP-binding protein | - |
JKV48_RS05110 (JKV48_05085) | 1051807..1052664 | + | 858 | WP_000370919.1 | HAD family hydrolase | - |
JKV48_RS05115 | 1052858..1053072 | - | 215 | Protein_1010 | exotoxin | - |
JKV48_RS05120 (JKV48_05090) | 1053359..1053451 | - | 93 | WP_031844941.1 | hypothetical protein | - |
JKV48_RS05125 (JKV48_05095) | 1053740..1054876 | + | 1137 | Protein_1012 | SAP domain-containing protein | - |
JKV48_RS05130 (JKV48_05100) | 1054919..1055402 | + | 484 | Protein_1013 | recombinase family protein | - |
JKV48_RS05135 (JKV48_05105) | 1055563..1055667 | + | 105 | WP_001802298.1 | hypothetical protein | Toxin |
- | 1055663..1055842 | - | 180 | - | - | Antitoxin |
JKV48_RS05145 (JKV48_05110) | 1056116..1057207 | - | 1092 | WP_000495695.1 | hypothetical protein | - |
JKV48_RS05150 (JKV48_05115) | 1057473..1058450 | - | 978 | WP_000019732.1 | CDF family zinc efflux transporter CzrB | - |
JKV48_RS05155 (JKV48_05120) | 1058452..1058772 | - | 321 | WP_000139802.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
JKV48_RS05160 (JKV48_05125) | 1058924..1059589 | + | 666 | WP_001024088.1 | SDR family oxidoreductase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T187521 WP_001802298.1 NZ_CP068682:1055563-1055667 [Staphylococcus aureus]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T187521 NZ_CP089880:3872010-3872228 [Klebsiella pneumoniae]
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATTCCGACCTCTGTCTGGAAATTTATCCGCTAA
ATGTCTGATAAGCCATTAACTAAAACAGACTATTTGATGCGCTTACGTCGTTGCCAGACAATTGACACGCTGGAGCGCGT
CATTGAAAAAAATAAATATGAACTGTCTGATAATGAGCTGGCGGTATTTTACTCAGCTGCCGACCATCGTCTGGCGGAAC
TGACCATGAATAAGCTATACGATAAAATTCCGACCTCTGTCTGGAAATTTATCCGCTAA
Antitoxin
Download Length: 180 bp
>AT187521 NZ_CP068682:c1055842-1055663 [Staphylococcus aureus]
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
GTGTTAAAATATATTTGTAGTAAGTAGAAGCAAAAGATGAAAATCTTTAACTCTTGAAACACAAAAAGGGCAACACTCGG
AAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTGACCTTATATTTTATTTAAAAATAGCCTTCAAAAATGCCGGTC
AAAGCGAATAGAAGGTTATT
Structures
Toxin
Loading, please wait
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I7Y9L9 |