Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 75112..75381 | Replicon | plasmid unnamed |
Accession | NZ_CP068681 | ||
Organism | Escherichia coli strain NCCP12480 |
Toxin (Protein)
Gene name | hok | Uniprot ID | G9G195 |
Locus tag | JKV47_RS22330 | Protein ID | WP_001323520.1 |
Coordinates | 75265..75381 (+) | Length | 39 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 75112..75177 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JKV47_RS22280 | 70493..70662 | + | 170 | Protein_70 | hypothetical protein | - |
JKV47_RS22285 | 70845..70925 | - | 81 | Protein_71 | hypothetical protein | - |
JKV47_RS22290 | 70995..71201 | + | 207 | WP_000275856.1 | hypothetical protein | - |
JKV47_RS22295 | 71227..71766 | + | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
JKV47_RS22300 | 71834..72067 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
JKV47_RS22305 | 72095..72292 | + | 198 | Protein_75 | hypothetical protein | - |
JKV47_RS22310 | 72347..72781 | + | 435 | WP_000845936.1 | conjugation system SOS inhibitor PsiB | - |
JKV47_RS22315 | 72778..73540 | + | 763 | Protein_77 | plasmid SOS inhibition protein A | - |
- | 73509..73611 | + | 103 | NuclAT_1 | - | - |
- | 73509..73611 | + | 103 | NuclAT_1 | - | - |
- | 73509..73611 | + | 103 | NuclAT_1 | - | - |
- | 73509..73611 | + | 103 | NuclAT_1 | - | - |
JKV47_RS22320 | 73657..75026 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
- | 75053..75179 | + | 127 | NuclAT_0 | - | - |
- | 75053..75179 | + | 127 | NuclAT_0 | - | - |
- | 75053..75179 | + | 127 | NuclAT_0 | - | - |
- | 75053..75179 | + | 127 | NuclAT_0 | - | - |
- | 75112..75177 | - | 66 | - | - | Antitoxin |
JKV47_RS22325 | 75165..75314 | + | 150 | Protein_79 | plasmid maintenance protein Mok | - |
JKV47_RS22330 | 75265..75381 | + | 117 | WP_001323520.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JKV47_RS22335 | 75601..75831 | + | 231 | WP_071586998.1 | hypothetical protein | - |
JKV47_RS22340 | 75829..76001 | - | 173 | Protein_82 | hypothetical protein | - |
JKV47_RS22345 | 76071..76277 | + | 207 | WP_000547968.1 | hypothetical protein | - |
JKV47_RS22350 | 76302..76589 | + | 288 | WP_000107535.1 | hypothetical protein | - |
JKV47_RS22355 | 76707..77528 | + | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
JKV47_RS22360 | 77825..78427 | - | 603 | WP_000243712.1 | transglycosylase SLT domain-containing protein | - |
JKV47_RS22365 | 78748..79131 | + | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
JKV47_RS22370 | 79318..80007 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | sitABCD | iroN / iroE / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA | 1..82394 | 82394 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 39 a.a. Molecular weight: 4455.23 Da Isoelectric Point: 8.5110
>T187512 WP_001323520.1 NZ_CP068681:75265-75381 [Escherichia coli]
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 117 bp
>T187512 NZ_CP089877:c5187385-5187002 [Klebsiella pneumoniae]
ATGACCTCCGGATCTGCGCTTTTTGATACCAATATTCTTATTGATTTATTTAGCGGGCGTCGCGAAGCCAAACAGGCGCT
GGAGGCCTGGCCACCGCAGAATGCGATCAGTCTGATTACCTGGATGGAGGTGATGGTTGGCGCTAAAAAATATCACCAGG
AGCAGCGCACGCGAATGGCGCTGAGCACCTTTAATATCATTAACATCTCACAGGATATTGCAGAGCGAAGCGTTGCGCTG
CGGCAGGAGTATAAGCTTAAGCTGCCGGATGCCATCATTCTGGCGACGGCGCAACTCCATCGTCTGGAACTAATTACGCG
GAATACGAAGGATTTTGCCGGTATTCCTGGCGTAGTCACGCCGTACGAAATCCACCCTGAATAA
ATGACCTCCGGATCTGCGCTTTTTGATACCAATATTCTTATTGATTTATTTAGCGGGCGTCGCGAAGCCAAACAGGCGCT
GGAGGCCTGGCCACCGCAGAATGCGATCAGTCTGATTACCTGGATGGAGGTGATGGTTGGCGCTAAAAAATATCACCAGG
AGCAGCGCACGCGAATGGCGCTGAGCACCTTTAATATCATTAACATCTCACAGGATATTGCAGAGCGAAGCGTTGCGCTG
CGGCAGGAGTATAAGCTTAAGCTGCCGGATGCCATCATTCTGGCGACGGCGCAACTCCATCGTCTGGAACTAATTACGCG
GAATACGAAGGATTTTGCCGGTATTCCTGGCGTAGTCACGCCGTACGAAATCCACCCTGAATAA
Antitoxin
Download Length: 66 bp
>AT187512 NZ_CP068681:c75177-75112 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|