Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 2181453..2181674 | Replicon | chromosome |
| Accession | NZ_CP068591 | ||
| Organism | Escherichia coli strain EF7-18-58 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E0IV43 |
| Locus tag | JMY44_RS10270 | Protein ID | WP_000170926.1 |
| Coordinates | 2181453..2181560 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 2181613..2181674 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JMY44_RS10240 | 2176762..2177844 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| JMY44_RS10245 | 2177844..2178677 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| JMY44_RS10250 | 2178674..2179066 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| JMY44_RS10255 | 2179070..2179879 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| JMY44_RS10260 | 2179915..2180769 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| JMY44_RS10265 | 2180918..2181025 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2181073..2181139 | + | 67 | NuclAT_50 | - | - |
| - | 2181073..2181139 | + | 67 | NuclAT_50 | - | - |
| - | 2181073..2181139 | + | 67 | NuclAT_50 | - | - |
| - | 2181073..2181139 | + | 67 | NuclAT_50 | - | - |
| - | 2181073..2181139 | + | 67 | NuclAT_53 | - | - |
| - | 2181073..2181139 | + | 67 | NuclAT_53 | - | - |
| - | 2181073..2181139 | + | 67 | NuclAT_53 | - | - |
| - | 2181073..2181139 | + | 67 | NuclAT_53 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_15 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_15 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_15 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_15 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_18 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_18 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_18 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_18 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_21 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_21 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_21 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_21 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_24 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_24 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_24 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_24 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_27 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_27 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_27 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_27 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_30 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_30 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_30 | - | - |
| - | 2181075..2181138 | + | 64 | NuclAT_30 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_33 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_33 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_33 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_33 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_36 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_36 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_36 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_36 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_39 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_39 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_39 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_39 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_42 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_42 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_42 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_42 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_45 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_45 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_45 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_45 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_48 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_48 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_48 | - | - |
| - | 2181075..2181140 | + | 66 | NuclAT_48 | - | - |
| JMY44_RS10270 | 2181453..2181560 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2181613..2181674 | + | 62 | NuclAT_16 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_16 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_16 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_16 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_19 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_19 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_19 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_19 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_22 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_22 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_22 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_22 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_25 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_25 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_25 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_25 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_28 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_28 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_28 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_28 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_31 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_31 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_31 | - | Antitoxin |
| - | 2181613..2181674 | + | 62 | NuclAT_31 | - | Antitoxin |
| - | 2181613..2181675 | + | 63 | NuclAT_51 | - | - |
| - | 2181613..2181675 | + | 63 | NuclAT_51 | - | - |
| - | 2181613..2181675 | + | 63 | NuclAT_51 | - | - |
| - | 2181613..2181675 | + | 63 | NuclAT_51 | - | - |
| - | 2181613..2181675 | + | 63 | NuclAT_54 | - | - |
| - | 2181613..2181675 | + | 63 | NuclAT_54 | - | - |
| - | 2181613..2181675 | + | 63 | NuclAT_54 | - | - |
| - | 2181613..2181675 | + | 63 | NuclAT_54 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_34 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_34 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_34 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_34 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_37 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_37 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_37 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_37 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_40 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_40 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_40 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_40 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_43 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_43 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_43 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_43 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_46 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_46 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_46 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_46 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_49 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_49 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_49 | - | - |
| - | 2181613..2181676 | + | 64 | NuclAT_49 | - | - |
| JMY44_RS10275 | 2181989..2182096 | - | 108 | WP_074147554.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2182144..2182209 | + | 66 | NuclAT_14 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_14 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_14 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_14 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_17 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_17 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_17 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_17 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_20 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_20 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_20 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_20 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_23 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_23 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_23 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_23 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_26 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_26 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_26 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_26 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_29 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_29 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_29 | - | - |
| - | 2182144..2182209 | + | 66 | NuclAT_29 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_32 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_32 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_32 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_32 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_35 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_35 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_35 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_35 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_38 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_38 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_38 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_38 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_41 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_41 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_41 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_41 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_44 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_44 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_44 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_44 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_47 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_47 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_47 | - | - |
| - | 2182144..2182211 | + | 68 | NuclAT_47 | - | - |
| - | 2182145..2182210 | + | 66 | NuclAT_52 | - | - |
| - | 2182145..2182210 | + | 66 | NuclAT_52 | - | - |
| - | 2182145..2182210 | + | 66 | NuclAT_52 | - | - |
| - | 2182145..2182210 | + | 66 | NuclAT_52 | - | - |
| - | 2182145..2182210 | + | 66 | NuclAT_55 | - | - |
| - | 2182145..2182210 | + | 66 | NuclAT_55 | - | - |
| - | 2182145..2182210 | + | 66 | NuclAT_55 | - | - |
| - | 2182145..2182210 | + | 66 | NuclAT_55 | - | - |
| JMY44_RS10280 | 2182501..2183601 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| JMY44_RS10285 | 2183871..2184101 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| JMY44_RS10290 | 2184259..2184954 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| JMY44_RS10295 | 2184998..2185351 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T187336 WP_000170926.1 NZ_CP068591:c2181560-2181453 [Escherichia coli]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T187336 NZ_CP089781:3762203-3762460 [Mycobacterium tuberculosis]
GTGAGAAGCGTCAACTTCGATCCCGATGCCTGGGAGGACTTCTTGTTCTGGCTGGCCGCTGATCGCAAAACGGCCCGTCG
GATCACCCGGTTGATCGGAGAAATTCAGCGTGATCCGTTCAGCGGGATCGGCAAACCCGAGCCGCTCCAAGGTGAGTTGT
CGGGATACTGGTCGCGCCGGATCGACGACGAACACCGGCTGGTGTATCGAGCGGGCGACGACGAAGTCACGATGCTGAAG
GCCCGATACCACTACTGA
GTGAGAAGCGTCAACTTCGATCCCGATGCCTGGGAGGACTTCTTGTTCTGGCTGGCCGCTGATCGCAAAACGGCCCGTCG
GATCACCCGGTTGATCGGAGAAATTCAGCGTGATCCGTTCAGCGGGATCGGCAAACCCGAGCCGCTCCAAGGTGAGTTGT
CGGGATACTGGTCGCGCCGGATCGACGACGAACACCGGCTGGTGTATCGAGCGGGCGACGACGAAGTCACGATGCTGAAG
GCCCGATACCACTACTGA
Antitoxin
Download Length: 62 bp
>AT187336 NZ_CP068591:2181613-2181674 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|