Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1305054..1305276 | Replicon | chromosome |
| Accession | NZ_CP068283 | ||
| Organism | Escherichia coli strain CY598 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | D3H2K1 |
| Locus tag | JI738_RS06480 | Protein ID | WP_000170955.1 |
| Coordinates | 1305054..1305161 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1305209..1305276 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JI738_RS06450 (1300910) | 1300910..1301743 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| JI738_RS06455 (1301740) | 1301740..1302132 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
| JI738_RS06460 (1302136) | 1302136..1302945 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| JI738_RS06465 (1302981) | 1302981..1303835 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| JI738_RS06470 (1303984) | 1303984..1304091 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_34 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_34 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_34 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_34 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_36 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_36 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_36 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_36 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_38 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_38 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_38 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_38 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_40 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_40 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_40 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_40 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_42 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_42 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_42 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_42 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_44 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_44 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_44 | - | - |
| - (1304139) | 1304139..1304205 | + | 67 | NuclAT_44 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_18 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_18 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_18 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_18 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_21 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_21 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_21 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_21 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_24 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_24 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_24 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_24 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_27 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_27 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_27 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_27 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_30 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_30 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_30 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_30 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_33 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_33 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_33 | - | - |
| - (1304141) | 1304141..1304206 | + | 66 | NuclAT_33 | - | - |
| JI738_RS06475 (1304519) | 1304519..1304626 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_35 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_35 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_35 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_35 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_37 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_37 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_37 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_37 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_39 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_39 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_39 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_39 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_41 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_41 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_41 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_41 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_43 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_43 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_43 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_43 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_45 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_45 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_45 | - | - |
| - (1304675) | 1304675..1304740 | + | 66 | NuclAT_45 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_17 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_17 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_17 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_17 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_20 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_20 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_20 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_20 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_23 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_23 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_23 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_23 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_26 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_26 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_26 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_26 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_29 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_29 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_29 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_29 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_32 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_32 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_32 | - | - |
| - (1304674) | 1304674..1304741 | + | 68 | NuclAT_32 | - | - |
| JI738_RS06480 (1305054) | 1305054..1305161 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_16 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_19 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_22 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_25 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_28 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_31 | - | Antitoxin |
| - (1305209) | 1305209..1305276 | + | 68 | NuclAT_31 | - | Antitoxin |
| JI738_RS06485 (1305565) | 1305565..1306665 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
| JI738_RS06490 (1306935) | 1306935..1307165 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
| JI738_RS06495 (1307323) | 1307323..1308018 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| JI738_RS06500 (1308062) | 1308062..1308415 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| JI738_RS06505 (1308600) | 1308600..1309994 | + | 1395 | WP_000086217.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4013.82 Da Isoelectric Point: 11.4779
>T187087 WP_000170955.1 NZ_CP068283:c1305161-1305054 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T187087 NZ_CP089777:c2871906-2871487 [Mycobacterium tuberculosis]
GTGACGGCACTGCTCGATGTCAATGTGCTGATCGCGCTGGGCTGGCCGAATCACGTTCACCATGCGGCCGCGCAGCGATG
GTTCACGCAGTTCTCCTCGAATGGGTGGGCCACCACGCCGATCACCGAGGCAGGGTATGTCCGAATTTCAAGCAATCGCA
GTGTGATGCAGGTGTCGACCACGCCGGCTATCGCGATCGCTCAGTTGGCGGCGATGACTTCTCTTGCCGGGCACACGTTT
TGGCCTGACGATGTGCCACTGATCGTTGGGAGCGCCGGCGATCGCGATGCGGTGTCCAACCACCGTCGGGTCACCGACTG
CCATCTCATCGCCTTGGCCGCGCGCTACGGGGGCCGGTTGGTCACATTCGATGCCGCACTGGCCGATTCAGCATCCGCAG
GCCTCGTCGAGGTGTTGTAG
GTGACGGCACTGCTCGATGTCAATGTGCTGATCGCGCTGGGCTGGCCGAATCACGTTCACCATGCGGCCGCGCAGCGATG
GTTCACGCAGTTCTCCTCGAATGGGTGGGCCACCACGCCGATCACCGAGGCAGGGTATGTCCGAATTTCAAGCAATCGCA
GTGTGATGCAGGTGTCGACCACGCCGGCTATCGCGATCGCTCAGTTGGCGGCGATGACTTCTCTTGCCGGGCACACGTTT
TGGCCTGACGATGTGCCACTGATCGTTGGGAGCGCCGGCGATCGCGATGCGGTGTCCAACCACCGTCGGGTCACCGACTG
CCATCTCATCGCCTTGGCCGCGCGCTACGGGGGCCGGTTGGTCACATTCGATGCCGCACTGGCCGATTCAGCATCCGCAG
GCCTCGTCGAGGTGTTGTAG
Antitoxin
Download Length: 68 bp
>AT187087 NZ_CP068283:1305209-1305276 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|