Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1304519..1304741 Replicon chromosome
Accession NZ_CP068283
Organism Escherichia coli strain CY598

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag JI738_RS06475 Protein ID WP_000170963.1
Coordinates 1304519..1304626 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1304674..1304741 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JI738_RS06445 (1299828) 1299828..1300910 + 1083 WP_000804726.1 peptide chain release factor 1 -
JI738_RS06450 (1300910) 1300910..1301743 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
JI738_RS06455 (1301740) 1301740..1302132 + 393 WP_000200374.1 invasion regulator SirB2 -
JI738_RS06460 (1302136) 1302136..1302945 + 810 WP_001257044.1 invasion regulator SirB1 -
JI738_RS06465 (1302981) 1302981..1303835 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JI738_RS06470 (1303984) 1303984..1304091 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1304139) 1304139..1304205 + 67 NuclAT_34 - -
- (1304139) 1304139..1304205 + 67 NuclAT_34 - -
- (1304139) 1304139..1304205 + 67 NuclAT_34 - -
- (1304139) 1304139..1304205 + 67 NuclAT_34 - -
- (1304139) 1304139..1304205 + 67 NuclAT_36 - -
- (1304139) 1304139..1304205 + 67 NuclAT_36 - -
- (1304139) 1304139..1304205 + 67 NuclAT_36 - -
- (1304139) 1304139..1304205 + 67 NuclAT_36 - -
- (1304139) 1304139..1304205 + 67 NuclAT_38 - -
- (1304139) 1304139..1304205 + 67 NuclAT_38 - -
- (1304139) 1304139..1304205 + 67 NuclAT_38 - -
- (1304139) 1304139..1304205 + 67 NuclAT_38 - -
- (1304139) 1304139..1304205 + 67 NuclAT_40 - -
- (1304139) 1304139..1304205 + 67 NuclAT_40 - -
- (1304139) 1304139..1304205 + 67 NuclAT_40 - -
- (1304139) 1304139..1304205 + 67 NuclAT_40 - -
- (1304139) 1304139..1304205 + 67 NuclAT_42 - -
- (1304139) 1304139..1304205 + 67 NuclAT_42 - -
- (1304139) 1304139..1304205 + 67 NuclAT_42 - -
- (1304139) 1304139..1304205 + 67 NuclAT_42 - -
- (1304139) 1304139..1304205 + 67 NuclAT_44 - -
- (1304139) 1304139..1304205 + 67 NuclAT_44 - -
- (1304139) 1304139..1304205 + 67 NuclAT_44 - -
- (1304139) 1304139..1304205 + 67 NuclAT_44 - -
- (1304141) 1304141..1304206 + 66 NuclAT_18 - -
- (1304141) 1304141..1304206 + 66 NuclAT_18 - -
- (1304141) 1304141..1304206 + 66 NuclAT_18 - -
- (1304141) 1304141..1304206 + 66 NuclAT_18 - -
- (1304141) 1304141..1304206 + 66 NuclAT_21 - -
- (1304141) 1304141..1304206 + 66 NuclAT_21 - -
- (1304141) 1304141..1304206 + 66 NuclAT_21 - -
- (1304141) 1304141..1304206 + 66 NuclAT_21 - -
- (1304141) 1304141..1304206 + 66 NuclAT_24 - -
- (1304141) 1304141..1304206 + 66 NuclAT_24 - -
- (1304141) 1304141..1304206 + 66 NuclAT_24 - -
- (1304141) 1304141..1304206 + 66 NuclAT_24 - -
- (1304141) 1304141..1304206 + 66 NuclAT_27 - -
- (1304141) 1304141..1304206 + 66 NuclAT_27 - -
- (1304141) 1304141..1304206 + 66 NuclAT_27 - -
- (1304141) 1304141..1304206 + 66 NuclAT_27 - -
- (1304141) 1304141..1304206 + 66 NuclAT_30 - -
- (1304141) 1304141..1304206 + 66 NuclAT_30 - -
- (1304141) 1304141..1304206 + 66 NuclAT_30 - -
- (1304141) 1304141..1304206 + 66 NuclAT_30 - -
- (1304141) 1304141..1304206 + 66 NuclAT_33 - -
- (1304141) 1304141..1304206 + 66 NuclAT_33 - -
- (1304141) 1304141..1304206 + 66 NuclAT_33 - -
- (1304141) 1304141..1304206 + 66 NuclAT_33 - -
JI738_RS06475 (1304519) 1304519..1304626 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1304675) 1304675..1304740 + 66 NuclAT_35 - -
- (1304675) 1304675..1304740 + 66 NuclAT_35 - -
- (1304675) 1304675..1304740 + 66 NuclAT_35 - -
- (1304675) 1304675..1304740 + 66 NuclAT_35 - -
- (1304675) 1304675..1304740 + 66 NuclAT_37 - -
- (1304675) 1304675..1304740 + 66 NuclAT_37 - -
- (1304675) 1304675..1304740 + 66 NuclAT_37 - -
- (1304675) 1304675..1304740 + 66 NuclAT_37 - -
- (1304675) 1304675..1304740 + 66 NuclAT_39 - -
- (1304675) 1304675..1304740 + 66 NuclAT_39 - -
- (1304675) 1304675..1304740 + 66 NuclAT_39 - -
- (1304675) 1304675..1304740 + 66 NuclAT_39 - -
- (1304675) 1304675..1304740 + 66 NuclAT_41 - -
- (1304675) 1304675..1304740 + 66 NuclAT_41 - -
- (1304675) 1304675..1304740 + 66 NuclAT_41 - -
- (1304675) 1304675..1304740 + 66 NuclAT_41 - -
- (1304675) 1304675..1304740 + 66 NuclAT_43 - -
- (1304675) 1304675..1304740 + 66 NuclAT_43 - -
- (1304675) 1304675..1304740 + 66 NuclAT_43 - -
- (1304675) 1304675..1304740 + 66 NuclAT_43 - -
- (1304675) 1304675..1304740 + 66 NuclAT_45 - -
- (1304675) 1304675..1304740 + 66 NuclAT_45 - -
- (1304675) 1304675..1304740 + 66 NuclAT_45 - -
- (1304675) 1304675..1304740 + 66 NuclAT_45 - -
- (1304674) 1304674..1304741 + 68 NuclAT_17 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_17 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_17 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_17 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_20 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_20 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_20 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_20 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_23 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_23 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_23 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_23 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_26 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_26 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_26 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_26 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_29 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_29 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_29 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_29 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_32 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_32 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_32 - Antitoxin
- (1304674) 1304674..1304741 + 68 NuclAT_32 - Antitoxin
JI738_RS06480 (1305054) 1305054..1305161 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (1305209) 1305209..1305276 + 68 NuclAT_16 - -
- (1305209) 1305209..1305276 + 68 NuclAT_16 - -
- (1305209) 1305209..1305276 + 68 NuclAT_16 - -
- (1305209) 1305209..1305276 + 68 NuclAT_16 - -
- (1305209) 1305209..1305276 + 68 NuclAT_19 - -
- (1305209) 1305209..1305276 + 68 NuclAT_19 - -
- (1305209) 1305209..1305276 + 68 NuclAT_19 - -
- (1305209) 1305209..1305276 + 68 NuclAT_19 - -
- (1305209) 1305209..1305276 + 68 NuclAT_22 - -
- (1305209) 1305209..1305276 + 68 NuclAT_22 - -
- (1305209) 1305209..1305276 + 68 NuclAT_22 - -
- (1305209) 1305209..1305276 + 68 NuclAT_22 - -
- (1305209) 1305209..1305276 + 68 NuclAT_25 - -
- (1305209) 1305209..1305276 + 68 NuclAT_25 - -
- (1305209) 1305209..1305276 + 68 NuclAT_25 - -
- (1305209) 1305209..1305276 + 68 NuclAT_25 - -
- (1305209) 1305209..1305276 + 68 NuclAT_28 - -
- (1305209) 1305209..1305276 + 68 NuclAT_28 - -
- (1305209) 1305209..1305276 + 68 NuclAT_28 - -
- (1305209) 1305209..1305276 + 68 NuclAT_28 - -
- (1305209) 1305209..1305276 + 68 NuclAT_31 - -
- (1305209) 1305209..1305276 + 68 NuclAT_31 - -
- (1305209) 1305209..1305276 + 68 NuclAT_31 - -
- (1305209) 1305209..1305276 + 68 NuclAT_31 - -
JI738_RS06485 (1305565) 1305565..1306665 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
JI738_RS06490 (1306935) 1306935..1307165 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JI738_RS06495 (1307323) 1307323..1308018 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
JI738_RS06500 (1308062) 1308062..1308415 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T187084 WP_000170963.1 NZ_CP068283:c1304626-1304519 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T187084 NZ_CP089777:c2384434-2384000 [Mycobacterium tuberculosis]
ATGAAGATCGTCGACGCGAACGTCTTGCTCTACGCCGTGAACACCACAAGTGAGCACCACAAGCCGTCGCTGCGCTGGCT
TGACGGTGCGCTGTCGGGCGCCGACCGCGTCGGGTTCGCCTGGGTGCCGTTGTTGGCGTTCGTGCGATTGGCGACCAAGG
TGGGGTTGTTCCCCCGTCCGCTTCCGCGGGAGGCGGCCATCACCCAGGTCGCGGATTGGCTAGCCGCACCCAGCGCCGTC
TTGGTGAATCCGACCGTCCGGCACGCCGATATCCTGGCGAGAATGCTGACGTACGTGGGAACCGGTGCCAACCTGGTCAA
CGACGCGCATCTGGCCGCGCTTGCCGTCGAGCATCGCGCCAGCATCGTGTCCTACGACAGTGACTTCGGCCGATTCGAAG
GGGTGCGCTGGGATCAGCCGCCCGCGCTGTTGTGA

Antitoxin


Download         Length: 68 bp

>AT187084 NZ_CP068283:1304674-1304741 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References