Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2513539..2513761 Replicon chromosome
Accession NZ_CP068281
Organism Escherichia coli strain CY706

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag JJW04_RS12230 Protein ID WP_000170955.1
Coordinates 2513539..2513646 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2513694..2513761 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JJW04_RS12200 (2509395) 2509395..2510228 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
JJW04_RS12205 (2510225) 2510225..2510617 + 393 WP_000200374.1 invasion regulator SirB2 -
JJW04_RS12210 (2510621) 2510621..2511430 + 810 WP_001257044.1 invasion regulator SirB1 -
JJW04_RS12215 (2511466) 2511466..2512320 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JJW04_RS12220 (2512469) 2512469..2512576 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2512624) 2512624..2512690 + 67 NuclAT_34 - -
- (2512624) 2512624..2512690 + 67 NuclAT_34 - -
- (2512624) 2512624..2512690 + 67 NuclAT_34 - -
- (2512624) 2512624..2512690 + 67 NuclAT_34 - -
- (2512624) 2512624..2512690 + 67 NuclAT_36 - -
- (2512624) 2512624..2512690 + 67 NuclAT_36 - -
- (2512624) 2512624..2512690 + 67 NuclAT_36 - -
- (2512624) 2512624..2512690 + 67 NuclAT_36 - -
- (2512624) 2512624..2512690 + 67 NuclAT_38 - -
- (2512624) 2512624..2512690 + 67 NuclAT_38 - -
- (2512624) 2512624..2512690 + 67 NuclAT_38 - -
- (2512624) 2512624..2512690 + 67 NuclAT_38 - -
- (2512624) 2512624..2512690 + 67 NuclAT_40 - -
- (2512624) 2512624..2512690 + 67 NuclAT_40 - -
- (2512624) 2512624..2512690 + 67 NuclAT_40 - -
- (2512624) 2512624..2512690 + 67 NuclAT_40 - -
- (2512624) 2512624..2512690 + 67 NuclAT_42 - -
- (2512624) 2512624..2512690 + 67 NuclAT_42 - -
- (2512624) 2512624..2512690 + 67 NuclAT_42 - -
- (2512624) 2512624..2512690 + 67 NuclAT_42 - -
- (2512624) 2512624..2512690 + 67 NuclAT_44 - -
- (2512624) 2512624..2512690 + 67 NuclAT_44 - -
- (2512624) 2512624..2512690 + 67 NuclAT_44 - -
- (2512624) 2512624..2512690 + 67 NuclAT_44 - -
- (2512626) 2512626..2512691 + 66 NuclAT_18 - -
- (2512626) 2512626..2512691 + 66 NuclAT_18 - -
- (2512626) 2512626..2512691 + 66 NuclAT_18 - -
- (2512626) 2512626..2512691 + 66 NuclAT_18 - -
- (2512626) 2512626..2512691 + 66 NuclAT_21 - -
- (2512626) 2512626..2512691 + 66 NuclAT_21 - -
- (2512626) 2512626..2512691 + 66 NuclAT_21 - -
- (2512626) 2512626..2512691 + 66 NuclAT_21 - -
- (2512626) 2512626..2512691 + 66 NuclAT_24 - -
- (2512626) 2512626..2512691 + 66 NuclAT_24 - -
- (2512626) 2512626..2512691 + 66 NuclAT_24 - -
- (2512626) 2512626..2512691 + 66 NuclAT_24 - -
- (2512626) 2512626..2512691 + 66 NuclAT_27 - -
- (2512626) 2512626..2512691 + 66 NuclAT_27 - -
- (2512626) 2512626..2512691 + 66 NuclAT_27 - -
- (2512626) 2512626..2512691 + 66 NuclAT_27 - -
- (2512626) 2512626..2512691 + 66 NuclAT_30 - -
- (2512626) 2512626..2512691 + 66 NuclAT_30 - -
- (2512626) 2512626..2512691 + 66 NuclAT_30 - -
- (2512626) 2512626..2512691 + 66 NuclAT_30 - -
- (2512626) 2512626..2512691 + 66 NuclAT_33 - -
- (2512626) 2512626..2512691 + 66 NuclAT_33 - -
- (2512626) 2512626..2512691 + 66 NuclAT_33 - -
- (2512626) 2512626..2512691 + 66 NuclAT_33 - -
JJW04_RS12225 (2513004) 2513004..2513111 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2513160) 2513160..2513225 + 66 NuclAT_35 - -
- (2513160) 2513160..2513225 + 66 NuclAT_35 - -
- (2513160) 2513160..2513225 + 66 NuclAT_35 - -
- (2513160) 2513160..2513225 + 66 NuclAT_35 - -
- (2513160) 2513160..2513225 + 66 NuclAT_37 - -
- (2513160) 2513160..2513225 + 66 NuclAT_37 - -
- (2513160) 2513160..2513225 + 66 NuclAT_37 - -
- (2513160) 2513160..2513225 + 66 NuclAT_37 - -
- (2513160) 2513160..2513225 + 66 NuclAT_39 - -
- (2513160) 2513160..2513225 + 66 NuclAT_39 - -
- (2513160) 2513160..2513225 + 66 NuclAT_39 - -
- (2513160) 2513160..2513225 + 66 NuclAT_39 - -
- (2513160) 2513160..2513225 + 66 NuclAT_41 - -
- (2513160) 2513160..2513225 + 66 NuclAT_41 - -
- (2513160) 2513160..2513225 + 66 NuclAT_41 - -
- (2513160) 2513160..2513225 + 66 NuclAT_41 - -
- (2513160) 2513160..2513225 + 66 NuclAT_43 - -
- (2513160) 2513160..2513225 + 66 NuclAT_43 - -
- (2513160) 2513160..2513225 + 66 NuclAT_43 - -
- (2513160) 2513160..2513225 + 66 NuclAT_43 - -
- (2513160) 2513160..2513225 + 66 NuclAT_45 - -
- (2513160) 2513160..2513225 + 66 NuclAT_45 - -
- (2513160) 2513160..2513225 + 66 NuclAT_45 - -
- (2513160) 2513160..2513225 + 66 NuclAT_45 - -
- (2513159) 2513159..2513226 + 68 NuclAT_17 - -
- (2513159) 2513159..2513226 + 68 NuclAT_17 - -
- (2513159) 2513159..2513226 + 68 NuclAT_17 - -
- (2513159) 2513159..2513226 + 68 NuclAT_17 - -
- (2513159) 2513159..2513226 + 68 NuclAT_20 - -
- (2513159) 2513159..2513226 + 68 NuclAT_20 - -
- (2513159) 2513159..2513226 + 68 NuclAT_20 - -
- (2513159) 2513159..2513226 + 68 NuclAT_20 - -
- (2513159) 2513159..2513226 + 68 NuclAT_23 - -
- (2513159) 2513159..2513226 + 68 NuclAT_23 - -
- (2513159) 2513159..2513226 + 68 NuclAT_23 - -
- (2513159) 2513159..2513226 + 68 NuclAT_23 - -
- (2513159) 2513159..2513226 + 68 NuclAT_26 - -
- (2513159) 2513159..2513226 + 68 NuclAT_26 - -
- (2513159) 2513159..2513226 + 68 NuclAT_26 - -
- (2513159) 2513159..2513226 + 68 NuclAT_26 - -
- (2513159) 2513159..2513226 + 68 NuclAT_29 - -
- (2513159) 2513159..2513226 + 68 NuclAT_29 - -
- (2513159) 2513159..2513226 + 68 NuclAT_29 - -
- (2513159) 2513159..2513226 + 68 NuclAT_29 - -
- (2513159) 2513159..2513226 + 68 NuclAT_32 - -
- (2513159) 2513159..2513226 + 68 NuclAT_32 - -
- (2513159) 2513159..2513226 + 68 NuclAT_32 - -
- (2513159) 2513159..2513226 + 68 NuclAT_32 - -
JJW04_RS12230 (2513539) 2513539..2513646 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2513694) 2513694..2513761 + 68 NuclAT_16 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_16 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_16 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_16 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_19 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_19 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_19 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_19 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_22 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_22 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_22 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_22 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_25 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_25 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_25 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_25 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_28 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_28 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_28 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_28 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_31 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_31 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_31 - Antitoxin
- (2513694) 2513694..2513761 + 68 NuclAT_31 - Antitoxin
JJW04_RS12235 (2514050) 2514050..2515150 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
JJW04_RS12240 (2515420) 2515420..2515650 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JJW04_RS12245 (2515808) 2515808..2516503 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
JJW04_RS12250 (2516547) 2516547..2516900 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
JJW04_RS12255 (2517085) 2517085..2518479 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T187049 WP_000170955.1 NZ_CP068281:c2513646-2513539 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T187049 NZ_CP089777:369363-369665 [Mycobacterium tuberculosis]
TTGATCGCTCCCGGCGACATCGCGCCGCGCCGCGACAGTGAACACGAGCTCTACGTCGCCGTCTTGTCCAACGCGCTCCA
TCGGGCCGCGGACACCGGACGGGTGATCACCTGCCCATTCATTCCGGGCCGGGTCCCCGAGGATCTCTTGGCGATGGTGG
TGGCGGTCGAGCAACCCAACGGCACGCTGCTGCCGGAACTCGTGCAGTGGCTTCATGTTGCCGCGCTCGGTGCGCCACTC
GGCAACGCGGGCGTGGCCGCCCTACGCGAGGCTGCCTCGGTCGTGACAGCTCTGCTCTGTTAG

Antitoxin


Download         Length: 68 bp

>AT187049 NZ_CP068281:2513694-2513761 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References