Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
Location | 2513004..2513226 | Replicon | chromosome |
Accession | NZ_CP068281 | ||
Organism | Escherichia coli strain CY706 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | J7R083 |
Locus tag | JJW04_RS12225 | Protein ID | WP_000170963.1 |
Coordinates | 2513004..2513111 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | rdlD | ||
Locus tag | - | ||
Coordinates | 2513159..2513226 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JJW04_RS12195 (2508313) | 2508313..2509395 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
JJW04_RS12200 (2509395) | 2509395..2510228 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
JJW04_RS12205 (2510225) | 2510225..2510617 | + | 393 | WP_000200374.1 | invasion regulator SirB2 | - |
JJW04_RS12210 (2510621) | 2510621..2511430 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
JJW04_RS12215 (2511466) | 2511466..2512320 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
JJW04_RS12220 (2512469) | 2512469..2512576 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_34 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_34 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_34 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_34 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_36 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_36 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_36 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_36 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_38 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_38 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_38 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_38 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_40 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_40 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_40 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_40 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_42 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_42 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_42 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_42 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_44 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_44 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_44 | - | - |
- (2512624) | 2512624..2512690 | + | 67 | NuclAT_44 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_18 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_18 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_18 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_18 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_21 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_21 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_21 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_21 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_24 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_24 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_24 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_24 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_27 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_27 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_27 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_27 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_30 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_30 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_30 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_30 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_33 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_33 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_33 | - | - |
- (2512626) | 2512626..2512691 | + | 66 | NuclAT_33 | - | - |
JJW04_RS12225 (2513004) | 2513004..2513111 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_35 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_35 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_35 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_35 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_37 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_37 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_37 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_37 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_39 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_39 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_39 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_39 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_41 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_41 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_41 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_41 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_43 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_43 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_43 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_43 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_45 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_45 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_45 | - | - |
- (2513160) | 2513160..2513225 | + | 66 | NuclAT_45 | - | - |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_17 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_17 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_17 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_17 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_20 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_20 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_20 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_20 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_23 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_23 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_23 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_23 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_26 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_26 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_26 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_26 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_29 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_29 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_29 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_29 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_32 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_32 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_32 | - | Antitoxin |
- (2513159) | 2513159..2513226 | + | 68 | NuclAT_32 | - | Antitoxin |
JJW04_RS12230 (2513539) | 2513539..2513646 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_16 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_16 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_16 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_16 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_19 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_19 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_19 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_19 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_22 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_22 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_22 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_22 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_25 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_25 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_25 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_25 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_28 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_28 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_28 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_28 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_31 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_31 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_31 | - | - |
- (2513694) | 2513694..2513761 | + | 68 | NuclAT_31 | - | - |
JJW04_RS12235 (2514050) | 2514050..2515150 | - | 1101 | WP_000063607.1 | sodium-potassium/proton antiporter ChaA | - |
JJW04_RS12240 (2515420) | 2515420..2515650 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
JJW04_RS12245 (2515808) | 2515808..2516503 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
JJW04_RS12250 (2516547) | 2516547..2516900 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T187046 WP_000170963.1 NZ_CP068281:c2513111-2513004 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T187046 NZ_CP089776:3820759-3821169 [Mycobacterium tuberculosis]
GTGATCTATATGGACACCTCGGCCCTGACTAAGCTGCTCATCTCCGAGCCCGAGACGACCGAACTGCGGACATGGCTGAC
CGCGCAAAGCGGCCAGGGCGAGGACGCGGCGACAAGCACCCTTGGCCGGGTCGAGTTGATGAGAGTCGTTGCCCGATACG
GACAACCAGGCCAAACTGAGCGTGCGCGTTACCTACTCGACGGGCTCGACATCCTCCCGCTCACCGAACCGGTGATCGGT
CTAGCTGAAACGATCGGACCGGCCACCCTACGTTCTCTCGACGCGATTCACCTCGCGGCCGCAGCCCAGATCAAGCGGGA
ACTGACAGCCTTCGTCACCTACGACCACCGATTGTTGAGCGGATGCCGTGAGGTCGGCTTCGTCACCGCCTCACCCGGCG
CAGTCCGGTGA
GTGATCTATATGGACACCTCGGCCCTGACTAAGCTGCTCATCTCCGAGCCCGAGACGACCGAACTGCGGACATGGCTGAC
CGCGCAAAGCGGCCAGGGCGAGGACGCGGCGACAAGCACCCTTGGCCGGGTCGAGTTGATGAGAGTCGTTGCCCGATACG
GACAACCAGGCCAAACTGAGCGTGCGCGTTACCTACTCGACGGGCTCGACATCCTCCCGCTCACCGAACCGGTGATCGGT
CTAGCTGAAACGATCGGACCGGCCACCCTACGTTCTCTCGACGCGATTCACCTCGCGGCCGCAGCCCAGATCAAGCGGGA
ACTGACAGCCTTCGTCACCTACGACCACCGATTGTTGAGCGGATGCCGTGAGGTCGGCTTCGTCACCGCCTCACCCGGCG
CAGTCCGGTGA
Antitoxin
Download Length: 68 bp
>AT187046 NZ_CP068281:2513159-2513226 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|