Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2458862..2459084 Replicon chromosome
Accession NZ_CP068279
Organism Escherichia coli strain CY708

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag JJW05_RS11965 Protein ID WP_000170963.1
Coordinates 2458862..2458969 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2459017..2459084 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JJW05_RS11935 (2454171) 2454171..2455253 + 1083 WP_000804726.1 peptide chain release factor 1 -
JJW05_RS11940 (2455253) 2455253..2456086 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
JJW05_RS11945 (2456083) 2456083..2456475 + 393 WP_000200374.1 invasion regulator SirB2 -
JJW05_RS11950 (2456479) 2456479..2457288 + 810 WP_001257044.1 invasion regulator SirB1 -
JJW05_RS11955 (2457324) 2457324..2458178 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JJW05_RS11960 (2458327) 2458327..2458434 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2458482) 2458482..2458548 + 67 NuclAT_33 - -
- (2458482) 2458482..2458548 + 67 NuclAT_33 - -
- (2458482) 2458482..2458548 + 67 NuclAT_33 - -
- (2458482) 2458482..2458548 + 67 NuclAT_33 - -
- (2458482) 2458482..2458548 + 67 NuclAT_35 - -
- (2458482) 2458482..2458548 + 67 NuclAT_35 - -
- (2458482) 2458482..2458548 + 67 NuclAT_35 - -
- (2458482) 2458482..2458548 + 67 NuclAT_35 - -
- (2458482) 2458482..2458548 + 67 NuclAT_37 - -
- (2458482) 2458482..2458548 + 67 NuclAT_37 - -
- (2458482) 2458482..2458548 + 67 NuclAT_37 - -
- (2458482) 2458482..2458548 + 67 NuclAT_37 - -
- (2458482) 2458482..2458548 + 67 NuclAT_39 - -
- (2458482) 2458482..2458548 + 67 NuclAT_39 - -
- (2458482) 2458482..2458548 + 67 NuclAT_39 - -
- (2458482) 2458482..2458548 + 67 NuclAT_39 - -
- (2458482) 2458482..2458548 + 67 NuclAT_41 - -
- (2458482) 2458482..2458548 + 67 NuclAT_41 - -
- (2458482) 2458482..2458548 + 67 NuclAT_41 - -
- (2458482) 2458482..2458548 + 67 NuclAT_41 - -
- (2458482) 2458482..2458548 + 67 NuclAT_43 - -
- (2458482) 2458482..2458548 + 67 NuclAT_43 - -
- (2458482) 2458482..2458548 + 67 NuclAT_43 - -
- (2458482) 2458482..2458548 + 67 NuclAT_43 - -
- (2458484) 2458484..2458549 + 66 NuclAT_17 - -
- (2458484) 2458484..2458549 + 66 NuclAT_17 - -
- (2458484) 2458484..2458549 + 66 NuclAT_17 - -
- (2458484) 2458484..2458549 + 66 NuclAT_17 - -
- (2458484) 2458484..2458549 + 66 NuclAT_20 - -
- (2458484) 2458484..2458549 + 66 NuclAT_20 - -
- (2458484) 2458484..2458549 + 66 NuclAT_20 - -
- (2458484) 2458484..2458549 + 66 NuclAT_20 - -
- (2458484) 2458484..2458549 + 66 NuclAT_23 - -
- (2458484) 2458484..2458549 + 66 NuclAT_23 - -
- (2458484) 2458484..2458549 + 66 NuclAT_23 - -
- (2458484) 2458484..2458549 + 66 NuclAT_23 - -
- (2458484) 2458484..2458549 + 66 NuclAT_26 - -
- (2458484) 2458484..2458549 + 66 NuclAT_26 - -
- (2458484) 2458484..2458549 + 66 NuclAT_26 - -
- (2458484) 2458484..2458549 + 66 NuclAT_26 - -
- (2458484) 2458484..2458549 + 66 NuclAT_29 - -
- (2458484) 2458484..2458549 + 66 NuclAT_29 - -
- (2458484) 2458484..2458549 + 66 NuclAT_29 - -
- (2458484) 2458484..2458549 + 66 NuclAT_29 - -
- (2458484) 2458484..2458549 + 66 NuclAT_32 - -
- (2458484) 2458484..2458549 + 66 NuclAT_32 - -
- (2458484) 2458484..2458549 + 66 NuclAT_32 - -
- (2458484) 2458484..2458549 + 66 NuclAT_32 - -
JJW05_RS11965 (2458862) 2458862..2458969 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2459018) 2459018..2459083 + 66 NuclAT_34 - -
- (2459018) 2459018..2459083 + 66 NuclAT_34 - -
- (2459018) 2459018..2459083 + 66 NuclAT_34 - -
- (2459018) 2459018..2459083 + 66 NuclAT_34 - -
- (2459018) 2459018..2459083 + 66 NuclAT_36 - -
- (2459018) 2459018..2459083 + 66 NuclAT_36 - -
- (2459018) 2459018..2459083 + 66 NuclAT_36 - -
- (2459018) 2459018..2459083 + 66 NuclAT_36 - -
- (2459018) 2459018..2459083 + 66 NuclAT_38 - -
- (2459018) 2459018..2459083 + 66 NuclAT_38 - -
- (2459018) 2459018..2459083 + 66 NuclAT_38 - -
- (2459018) 2459018..2459083 + 66 NuclAT_38 - -
- (2459018) 2459018..2459083 + 66 NuclAT_40 - -
- (2459018) 2459018..2459083 + 66 NuclAT_40 - -
- (2459018) 2459018..2459083 + 66 NuclAT_40 - -
- (2459018) 2459018..2459083 + 66 NuclAT_40 - -
- (2459018) 2459018..2459083 + 66 NuclAT_42 - -
- (2459018) 2459018..2459083 + 66 NuclAT_42 - -
- (2459018) 2459018..2459083 + 66 NuclAT_42 - -
- (2459018) 2459018..2459083 + 66 NuclAT_42 - -
- (2459018) 2459018..2459083 + 66 NuclAT_44 - -
- (2459018) 2459018..2459083 + 66 NuclAT_44 - -
- (2459018) 2459018..2459083 + 66 NuclAT_44 - -
- (2459018) 2459018..2459083 + 66 NuclAT_44 - -
- (2459017) 2459017..2459084 + 68 NuclAT_16 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_16 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_16 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_16 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_19 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_19 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_19 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_19 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_22 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_22 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_22 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_22 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_25 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_25 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_25 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_25 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_28 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_28 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_28 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_28 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_31 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_31 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_31 - Antitoxin
- (2459017) 2459017..2459084 + 68 NuclAT_31 - Antitoxin
JJW05_RS11970 (2459397) 2459397..2459504 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2459552) 2459552..2459619 + 68 NuclAT_15 - -
- (2459552) 2459552..2459619 + 68 NuclAT_15 - -
- (2459552) 2459552..2459619 + 68 NuclAT_15 - -
- (2459552) 2459552..2459619 + 68 NuclAT_15 - -
- (2459552) 2459552..2459619 + 68 NuclAT_18 - -
- (2459552) 2459552..2459619 + 68 NuclAT_18 - -
- (2459552) 2459552..2459619 + 68 NuclAT_18 - -
- (2459552) 2459552..2459619 + 68 NuclAT_18 - -
- (2459552) 2459552..2459619 + 68 NuclAT_21 - -
- (2459552) 2459552..2459619 + 68 NuclAT_21 - -
- (2459552) 2459552..2459619 + 68 NuclAT_21 - -
- (2459552) 2459552..2459619 + 68 NuclAT_21 - -
- (2459552) 2459552..2459619 + 68 NuclAT_24 - -
- (2459552) 2459552..2459619 + 68 NuclAT_24 - -
- (2459552) 2459552..2459619 + 68 NuclAT_24 - -
- (2459552) 2459552..2459619 + 68 NuclAT_24 - -
- (2459552) 2459552..2459619 + 68 NuclAT_27 - -
- (2459552) 2459552..2459619 + 68 NuclAT_27 - -
- (2459552) 2459552..2459619 + 68 NuclAT_27 - -
- (2459552) 2459552..2459619 + 68 NuclAT_27 - -
- (2459552) 2459552..2459619 + 68 NuclAT_30 - -
- (2459552) 2459552..2459619 + 68 NuclAT_30 - -
- (2459552) 2459552..2459619 + 68 NuclAT_30 - -
- (2459552) 2459552..2459619 + 68 NuclAT_30 - -
JJW05_RS11975 (2459908) 2459908..2461008 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
JJW05_RS11980 (2461278) 2461278..2461508 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JJW05_RS11985 (2461666) 2461666..2462361 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
JJW05_RS11990 (2462405) 2462405..2462758 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T187005 WP_000170963.1 NZ_CP068279:c2458969-2458862 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T187005 NZ_CP089776:847811-848239 [Mycobacterium tuberculosis]
ATGTTCCTTCTCGACGCCAACGTGCTGCTGGCTGCACACCGCGGTGACCACCCGAATCACCGAACCGTCCGCCCCTGGTT
CGATCGACTGCTCGCGGCTGACGACCCCTTCACAGTGCCGAACCTGGTATGGGCGTCGTTCCTCCGGCTGGCAACGAATC
GACGCATCTTCGAGATTCCGTCACCGCGAGCAGAGGCATTCGCATTCGTCGAAGCCGTCACCGCCCAGCCCCATCACCTT
CCGACGAACCCCGGTCCCAGACACCTCATGCTGCTGCGAAAACTCTGCGACGAGGCCGACGCATCGGGCGACTTGATACC
TGACGCGGTACTCGCGGCCATAGCAGTGGGGCATCACTGCGCCGTGGTGAGCCTGGACAGGGATTTCGCCCGGTTTGCCT
CGGTGCGCCACATTCGCCCGCCGCTCTAG

Antitoxin


Download         Length: 68 bp

>AT187005 NZ_CP068279:2459017-2459084 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References