Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 37055..37309 | Replicon | plasmid pABW_A32a |
| Accession | NZ_CP067304 | ||
| Organism | Escherichia coli strain ABW_A32 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | JJB23_RS22285 | Protein ID | WP_001312851.1 |
| Coordinates | 37055..37204 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 37248..37309 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JJB23_RS22250 (32607) | 32607..33008 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| JJB23_RS22255 (32941) | 32941..33198 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| JJB23_RS22260 (33291) | 33291..33944 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| JJB23_RS22265 (34883) | 34883..35740 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| JJB23_RS22270 (35733) | 35733..36215 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| JJB23_RS23550 (36208) | 36208..36255 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| JJB23_RS23555 (36246) | 36246..36497 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| JJB23_RS22280 (36514) | 36514..36771 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| JJB23_RS22285 (37055) | 37055..37204 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (37248) | 37248..37309 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (37248) | 37248..37309 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (37248) | 37248..37309 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (37248) | 37248..37309 | + | 62 | NuclAT_1 | - | Antitoxin |
| JJB23_RS22290 (37565) | 37565..37639 | - | 75 | Protein_47 | endonuclease | - |
| JJB23_RS22295 (37885) | 37885..38097 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| JJB23_RS22300 (38233) | 38233..38793 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| JJB23_RS22305 (38896) | 38896..39756 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| JJB23_RS22310 (39815) | 39815..40561 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / blaCTX-M-65 / aac(3)-IId / sitABCD | iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..126378 | 126378 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T186055 WP_001312851.1 NZ_CP067304:c37204-37055 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T186055 NZ_CP089162:89417-89626 [Staphylococcus aureus]
ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAGAAGAACAAGTAAGTCAATTGACAGAACGCATTTCAAA
TATGATAGGTGTTCATCAAGTGAATATTAATATAATAGATGGTCAAGTAACTGTATCGTATGAGACACCAGCAAATTTGA
ATAGTATTGAAAAAGAAATCTATGATGAAGGATACAAAATTGTATTTTAG
ATGATACATCAAAATACGATTTACACAGCGGGAATTGAAACAGAAGAACAAGTAAGTCAATTGACAGAACGCATTTCAAA
TATGATAGGTGTTCATCAAGTGAATATTAATATAATAGATGGTCAAGTAACTGTATCGTATGAGACACCAGCAAATTTGA
ATAGTATTGAAAAAGAAATCTATGATGAAGGATACAAAATTGTATTTTAG
Antitoxin
Download Length: 62 bp
>AT186055 NZ_CP067304:37248-37309 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|