Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 68078..68332 | Replicon | plasmid pABW_A33a |
| Accession | NZ_CP067300 | ||
| Organism | Escherichia coli strain ABW_A33 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | JJB24_RS22635 | Protein ID | WP_001312851.1 |
| Coordinates | 68078..68227 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 68271..68332 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JJB24_RS22600 (63630) | 63630..64031 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| JJB24_RS22605 (63964) | 63964..64221 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| JJB24_RS22610 (64314) | 64314..64967 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| JJB24_RS22615 (65906) | 65906..66763 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| JJB24_RS22620 (66756) | 66756..67238 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| JJB24_RS23880 (67231) | 67231..67278 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| JJB24_RS23885 (67269) | 67269..67520 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| JJB24_RS22630 (67537) | 67537..67794 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| JJB24_RS22635 (68078) | 68078..68227 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (68271) | 68271..68332 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68271) | 68271..68332 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68271) | 68271..68332 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (68271) | 68271..68332 | + | 62 | NuclAT_1 | - | Antitoxin |
| JJB24_RS22640 (68588) | 68588..68662 | - | 75 | Protein_85 | endonuclease | - |
| JJB24_RS22645 (68908) | 68908..69120 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| JJB24_RS22650 (69256) | 69256..69816 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| JJB24_RS22655 (69919) | 69919..70779 | - | 861 | WP_000704513.1 | alpha/beta hydrolase | - |
| JJB24_RS22660 (70838) | 70838..71584 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / mph(A) / sul1 / qacE / aadA5 / blaCTX-M-65 / aac(3)-IId / sitABCD | iroN / iroE / iroD / iroC / iroB / iutA / iucD / iucC / iucB / iucA | 1..157401 | 157401 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T186023 WP_001312851.1 NZ_CP067300:c68227-68078 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T186023 NZ_CP089154:2479423-2479530 [Staphylococcus aureus]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 62 bp
>AT186023 NZ_CP067300:68271-68332 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
