Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 91823..92056 | Replicon | plasmid pESBL_DR28a |
| Accession | NZ_CP067251 | ||
| Organism | Escherichia coli strain ESBL_DR28 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | JJB16_RS23440 | Protein ID | WP_001372321.1 |
| Coordinates | 91823..91948 (-) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 92025..92056 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JJB16_RS23415 (87197) | 87197..87886 | - | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
| JJB16_RS23420 (88073) | 88073..88456 | - | 384 | WP_001151524.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
| JJB16_RS23425 (88789) | 88789..89379 | + | 591 | WP_285835018.1 | transglycosylase SLT domain-containing protein | - |
| JJB16_RS23430 (89676) | 89676..90497 | - | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| JJB16_RS23435 (90615) | 90615..90902 | - | 288 | WP_000107535.1 | hypothetical protein | - |
| JJB16_RS24270 (90927) | 90927..91133 | - | 207 | WP_000547968.1 | hypothetical protein | - |
| JJB16_RS24275 (91203) | 91203..91375 | + | 173 | Protein_115 | hypothetical protein | - |
| JJB16_RS24280 (91373) | 91373..91603 | - | 231 | WP_071886920.1 | hypothetical protein | - |
| JJB16_RS23440 (91823) | 91823..91948 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| JJB16_RS24285 (91890) | 91890..92039 | - | 150 | Protein_118 | plasmid maintenance protein Mok | - |
| - (92025) | 92025..92056 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (92025) | 92025..92056 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (92025) | 92025..92056 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (92025) | 92025..92056 | - | 32 | NuclAT_1 | - | Antitoxin |
| - (93498) | 93498..93695 | - | 198 | NuclAT_0 | - | - |
| - (93498) | 93498..93695 | - | 198 | NuclAT_0 | - | - |
| - (93498) | 93498..93695 | - | 198 | NuclAT_0 | - | - |
| - (93498) | 93498..93695 | - | 198 | NuclAT_0 | - | - |
| JJB16_RS23450 (93507) | 93507..93695 | + | 189 | WP_001299721.1 | hypothetical protein | - |
| JJB16_RS23455 (93664) | 93664..94426 | - | 763 | Protein_121 | plasmid SOS inhibition protein A | - |
| JJB16_RS23460 (94423) | 94423..94857 | - | 435 | WP_000845937.1 | conjugation system SOS inhibitor PsiB | - |
| JJB16_RS23465 (94912) | 94912..95109 | - | 198 | Protein_123 | hypothetical protein | - |
| JJB16_RS23470 (95137) | 95137..95370 | - | 234 | WP_000005990.1 | DUF905 family protein | - |
| JJB16_RS23475 (95438) | 95438..95977 | - | 540 | WP_000290840.1 | single-stranded DNA-binding protein | - |
| JJB16_RS23480 (96003) | 96003..96209 | - | 207 | WP_000275856.1 | hypothetical protein | - |
| JJB16_RS24290 (96279) | 96279..96451 | + | 173 | Protein_127 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | sul1 / qacE / aadA5 / mph(A) / erm(B) / aac(3)-IId / fosA3 / blaCTX-M-65 / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..133432 | 133432 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T185928 WP_001372321.1 NZ_CP067251:c91948-91823 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T185928 NZ_CP089064:c2963398-2963117 [Pseudomonas aeruginosa]
ATGAGCCTGAAGTGGACCCGCAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCTCTGAAAGCCGTTCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCGTTTCGGGTTAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTGA
ATGAGCCTGAAGTGGACCCGCAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCTCTGAAAGCCGTTCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCGTTTCGGGTTAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTGA
Antitoxin
Download Length: 32 bp
>AT185928 NZ_CP067251:c92056-92025 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|