Detailed information of TA system TA185928

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 91823..92056
• Replicon: plasmid pESBL_DR28a
• Accession: NZ_CP067251
• Organism: Escherichia coli strain ESBL_DR28

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: JJB16_RS23440
• Protein ID: WP_001372321.1
• Coordinates: 91823..91948 (-)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	92025..92056 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JJB16_RS23415 (87197)	87197..87886	-	690	WP_000283385.1	conjugal transfer transcriptional regulator TraJ	-
JJB16_RS23420 (88073)	88073..88456	-	384	WP_001151524.1	conjugal transfer relaxosome DNA-binding protein TraM	-
JJB16_RS23425 (88789)	88789..89379	+	591	WP_285835018.1	transglycosylase SLT domain-containing protein	-
JJB16_RS23430 (89676)	89676..90497	-	822	WP_001234426.1	DUF932 domain-containing protein	-
JJB16_RS23435 (90615)	90615..90902	-	288	WP_000107535.1	hypothetical protein	-
JJB16_RS24270 (90927)	90927..91133	-	207	WP_000547968.1	hypothetical protein	-
JJB16_RS24275 (91203)	91203..91375	+	173	Protein_115	hypothetical protein	-
JJB16_RS24280 (91373)	91373..91603	-	231	WP_071886920.1	hypothetical protein	-
JJB16_RS23440 (91823)	91823..91948	-	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
JJB16_RS24285 (91890)	91890..92039	-	150	Protein_118	plasmid maintenance protein Mok	-
- (92025)	92025..92056	-	32	NuclAT_1	-	Antitoxin
- (92025)	92025..92056	-	32	NuclAT_1	-	Antitoxin
- (92025)	92025..92056	-	32	NuclAT_1	-	Antitoxin
- (92025)	92025..92056	-	32	NuclAT_1	-	Antitoxin
- (93498)	93498..93695	-	198	NuclAT_0	-	-
- (93498)	93498..93695	-	198	NuclAT_0	-	-
- (93498)	93498..93695	-	198	NuclAT_0	-	-
- (93498)	93498..93695	-	198	NuclAT_0	-	-
JJB16_RS23450 (93507)	93507..93695	+	189	WP_001299721.1	hypothetical protein	-
JJB16_RS23455 (93664)	93664..94426	-	763	Protein_121	plasmid SOS inhibition protein A	-
JJB16_RS23460 (94423)	94423..94857	-	435	WP_000845937.1	conjugation system SOS inhibitor PsiB	-
JJB16_RS23465 (94912)	94912..95109	-	198	Protein_123	hypothetical protein	-
JJB16_RS23470 (95137)	95137..95370	-	234	WP_000005990.1	DUF905 family protein	-
JJB16_RS23475 (95438)	95438..95977	-	540	WP_000290840.1	single-stranded DNA-binding protein	-
JJB16_RS23480 (96003)	96003..96209	-	207	WP_000275856.1	hypothetical protein	-
JJB16_RS24290 (96279)	96279..96451	+	173	Protein_127	hypothetical protein	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	sul1 / qacE / aadA5 / mph(A) / erm(B) / aac(3)-IId / fosA3 / blaCTX-M-65 / sitABCD	iutA / iucD / iucC / iucB / iucA	1..133432	133432

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T185928 WP_001372321.1 NZ_CP067251:c91948-91823 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

>T185928 NZ_CP089064:c2963398-2963117 [Pseudomonas aeruginosa]
ATGAGCCTGAAGTGGACCCGCAAGGCGGCCGCCGACCTGGACGCCATCTACGACCATTACGTCGTGCTGATCGGCCCGGA
AAAAGCTCTGAAAGCCGTTCAGGACATCGTCGAGCAGGTGAAACCGCTGCAGCAGGTAGCCAACCAGGGGGCAGGGCGGC
CCAGCGAGGTGCCAGGCGTACGCACCCTGACCCTGGAGCGCTGGCCGTTCAGCGCCCCGTTTCGGGTTAAAGGCAAGGAA
ATCCAGATTTTGCGCATCGACAGGGTCGAAATTACCCCCTGA

Antitoxin

Nucleotide

• Length: 32 bp

>AT185928 NZ_CP067251:c92056-92025 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin