Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 113892..114125 | Replicon | plasmid pP19_598a |
Accession | NZ_CP067242 | ||
Organism | Escherichia coli strain P19_598 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | JJB18_RS24580 | Protein ID | WP_001372321.1 |
Coordinates | 113892..114017 (-) | Length | 42 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 114094..114125 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JJB18_RS24545 (108938) | 108938..109165 | - | 228 | WP_001254386.1 | conjugal transfer relaxosome protein TraY | - |
JJB18_RS24550 (109259) | 109259..109945 | - | 687 | WP_000332484.1 | PAS domain-containing protein | - |
JJB18_RS24555 (110136) | 110136..110519 | - | 384 | WP_000124981.1 | conjugal transfer relaxosome DNA-binding protein TraM | - |
JJB18_RS24560 (110796) | 110796..111443 | + | 648 | WP_000614936.1 | transglycosylase SLT domain-containing protein | - |
JJB18_RS24565 (111740) | 111740..112561 | - | 822 | WP_001234469.1 | DUF932 domain-containing protein | - |
JJB18_RS24570 (112683) | 112683..112970 | - | 288 | WP_000107535.1 | hypothetical protein | - |
JJB18_RS24575 (112995) | 112995..113201 | - | 207 | WP_000547939.1 | hypothetical protein | - |
JJB18_RS25150 (113271) | 113271..113444 | + | 174 | Protein_140 | hypothetical protein | - |
JJB18_RS25155 (113442) | 113442..113672 | - | 231 | WP_001426396.1 | hypothetical protein | - |
JJB18_RS24580 (113892) | 113892..114017 | - | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JJB18_RS25160 (113959) | 113959..114108 | - | 150 | Protein_143 | plasmid maintenance protein Mok | - |
- (114094) | 114094..114125 | - | 32 | NuclAT_1 | - | Antitoxin |
- (114094) | 114094..114125 | - | 32 | NuclAT_1 | - | Antitoxin |
- (114094) | 114094..114125 | - | 32 | NuclAT_1 | - | Antitoxin |
- (114094) | 114094..114125 | - | 32 | NuclAT_1 | - | Antitoxin |
- (115567) | 115567..115764 | - | 198 | NuclAT_0 | - | - |
- (115567) | 115567..115764 | - | 198 | NuclAT_0 | - | - |
- (115567) | 115567..115764 | - | 198 | NuclAT_0 | - | - |
- (115567) | 115567..115764 | - | 198 | NuclAT_0 | - | - |
JJB18_RS24590 (115576) | 115576..115764 | + | 189 | WP_001299721.1 | hypothetical protein | - |
JJB18_RS24595 (115733) | 115733..116495 | - | 763 | Protein_146 | plasmid SOS inhibition protein A | - |
JJB18_RS24600 (116492) | 116492..116926 | - | 435 | WP_000845895.1 | conjugation system SOS inhibitor PsiB | - |
JJB18_RS24605 (116981) | 116981..118939 | - | 1959 | WP_001145469.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | floR / tet(A) / aph(6)-Id / aph(3'')-Ib / sul2 / fosA3 / blaCTX-M-27 / dfrA14 / aadA2 / cmlA1 / ant(3'')-Ia / sul3 / aph(3')-Ia / mph(A) / sitABCD | - | 1..144175 | 144175 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T185873 WP_001372321.1 NZ_CP067242:c114017-113892 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
>T185873 NZ_CP089036:3548449-3548736 [Escherichia coli O157:H7]
ATGTTACCCATTTTATGGCTACCGTCTGCTCGCGATGATTTGCGCCAGATCATAACTTACATCGCCAAGGAGAACCCACC
GGCAGCACGTAGACTAAAAATACGCATTGAAACATCGGTATTACCTCTATCTGAGCATCCGTACTTATATCCACCAAGCG
AACGGGTTTCTGGATTGAGAGAGATCGTGACCCACCCTAACTACATAATCCTGTACAGAGTAGCTGCTTCAAGCATTGAG
ATTGTAAGCGTGACACATTCTCGGCGACAATTTCCCTTCTCTATCTGA
ATGTTACCCATTTTATGGCTACCGTCTGCTCGCGATGATTTGCGCCAGATCATAACTTACATCGCCAAGGAGAACCCACC
GGCAGCACGTAGACTAAAAATACGCATTGAAACATCGGTATTACCTCTATCTGAGCATCCGTACTTATATCCACCAAGCG
AACGGGTTTCTGGATTGAGAGAGATCGTGACCCACCCTAACTACATAATCCTGTACAGAGTAGCTGCTTCAAGCATTGAG
ATTGTAAGCGTGACACATTCTCGGCGACAATTTCCCTTCTCTATCTGA
Antitoxin
Download Length: 32 bp
>AT185873 NZ_CP067242:c114125-114094 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|