Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 72583..72837 Replicon plasmid pSBF22a
Accession NZ_CP067236
Organism Escherichia coli strain SBF22

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag JJB19_RS24295 Protein ID WP_001312851.1
Coordinates 72583..72732 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 72776..72837 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JJB19_RS24260 (68146) 68146..68547 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
JJB19_RS24265 (68480) 68480..68737 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
JJB19_RS25695 (68830) 68830..69138 - 309 WP_226116723.1 CPBP family intramembrane metalloprotease -
JJB19_RS25700 (69080) 69080..69472 - 393 WP_000616804.1 histidine phosphatase family protein -
JJB19_RS24275 (70411) 70411..71268 - 858 WP_000774297.1 incFII family plasmid replication initiator RepA -
JJB19_RS24280 (71261) 71261..71743 - 483 WP_001273588.1 hypothetical protein -
JJB19_RS25705 (71736) 71736..71783 - 48 WP_229471593.1 hypothetical protein -
JJB19_RS25710 (71774) 71774..72025 + 252 WP_223195197.1 replication protein RepA -
JJB19_RS24290 (72042) 72042..72299 - 258 WP_000083845.1 replication regulatory protein RepA -
JJB19_RS24295 (72583) 72583..72732 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (72776) 72776..72837 + 62 NuclAT_1 - Antitoxin
- (72776) 72776..72837 + 62 NuclAT_1 - Antitoxin
- (72776) 72776..72837 + 62 NuclAT_1 - Antitoxin
- (72776) 72776..72837 + 62 NuclAT_1 - Antitoxin
JJB19_RS24300 (73093) 73093..73167 - 75 Protein_88 endonuclease -
JJB19_RS24305 (73413) 73413..73625 - 213 WP_001299730.1 ANR family transcriptional regulator -
JJB19_RS24310 (73761) 73761..74321 - 561 WP_000139315.1 fertility inhibition protein FinO -
JJB19_RS24315 (74424) 74424..75284 - 861 WP_000704514.1 alpha/beta hydrolase -
JJB19_RS24320 (75343) 75343..76089 - 747 WP_000205749.1 conjugal transfer pilus acetylase TraX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid tet(A) / blaTEM-1B / tet(B) / catA1 / blaCTX-M-65 / fosA3 / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / sitABCD afaC-I / iutA / iucD / iucC / iucB / iucA 1..122982 122982


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T185833 WP_001312851.1 NZ_CP067236:c72732-72583 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T185833 NZ_CP089034:290078-290185 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT185833 NZ_CP067236:72776-72837 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References