Detailed information of TA system TA185805

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 4256701..4256921
• Replicon: chromosome
• Accession: NZ_CP067232
• Organism: Escherichia coli strain SBF45

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: B7LGX8
• Locus tag: JJB20_RS20200
• Protein ID: WP_000170965.1
• Coordinates: 4256814..4256921 (+)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	4256701..4256767 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JJB20_RS20175	4251980..4253374	-	1395	WP_000086212.1	inverse autotransporter invasin YchO	-
JJB20_RS20180	4253559..4253912	+	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
JJB20_RS20185	4253956..4254651	-	696	WP_001297117.1	glutathione-specific gamma-glutamylcyclotransferase	-
JJB20_RS20190	4254809..4255039	-	231	WP_001146442.1	putative cation transport regulator ChaB	-
JJB20_RS20195	4255309..4256409	+	1101	WP_001295620.1	sodium-potassium/proton antiporter ChaA	-
-	4256701..4256767	-	67	-	-	Antitoxin
JJB20_RS20200	4256814..4256921	+	108	WP_000170965.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4257234..4257297	-	64	NuclAT_32	-	-
-	4257234..4257297	-	64	NuclAT_32	-	-
-	4257234..4257297	-	64	NuclAT_32	-	-
-	4257234..4257297	-	64	NuclAT_32	-	-
-	4257234..4257297	-	64	NuclAT_34	-	-
-	4257234..4257297	-	64	NuclAT_34	-	-
-	4257234..4257297	-	64	NuclAT_34	-	-
-	4257234..4257297	-	64	NuclAT_34	-	-
-	4257234..4257297	-	64	NuclAT_36	-	-
-	4257234..4257297	-	64	NuclAT_36	-	-
-	4257234..4257297	-	64	NuclAT_36	-	-
-	4257234..4257297	-	64	NuclAT_36	-	-
-	4257234..4257297	-	64	NuclAT_38	-	-
-	4257234..4257297	-	64	NuclAT_38	-	-
-	4257234..4257297	-	64	NuclAT_38	-	-
-	4257234..4257297	-	64	NuclAT_38	-	-
-	4257234..4257297	-	64	NuclAT_40	-	-
-	4257234..4257297	-	64	NuclAT_40	-	-
-	4257234..4257297	-	64	NuclAT_40	-	-
-	4257234..4257297	-	64	NuclAT_40	-	-
-	4257234..4257297	-	64	NuclAT_42	-	-
-	4257234..4257297	-	64	NuclAT_42	-	-
-	4257234..4257297	-	64	NuclAT_42	-	-
-	4257234..4257297	-	64	NuclAT_42	-	-
-	4257236..4257297	-	62	NuclAT_17	-	-
-	4257236..4257297	-	62	NuclAT_17	-	-
-	4257236..4257297	-	62	NuclAT_17	-	-
-	4257236..4257297	-	62	NuclAT_17	-	-
-	4257236..4257297	-	62	NuclAT_19	-	-
-	4257236..4257297	-	62	NuclAT_19	-	-
-	4257236..4257297	-	62	NuclAT_19	-	-
-	4257236..4257297	-	62	NuclAT_19	-	-
-	4257236..4257297	-	62	NuclAT_21	-	-
-	4257236..4257297	-	62	NuclAT_21	-	-
-	4257236..4257297	-	62	NuclAT_21	-	-
-	4257236..4257297	-	62	NuclAT_21	-	-
-	4257236..4257297	-	62	NuclAT_23	-	-
-	4257236..4257297	-	62	NuclAT_23	-	-
-	4257236..4257297	-	62	NuclAT_23	-	-
-	4257236..4257297	-	62	NuclAT_23	-	-
-	4257236..4257297	-	62	NuclAT_28	-	-
-	4257236..4257297	-	62	NuclAT_28	-	-
-	4257236..4257297	-	62	NuclAT_28	-	-
-	4257236..4257297	-	62	NuclAT_28	-	-
-	4257236..4257297	-	62	NuclAT_30	-	-
-	4257236..4257297	-	62	NuclAT_30	-	-
-	4257236..4257297	-	62	NuclAT_30	-	-
-	4257236..4257297	-	62	NuclAT_30	-	-
JJB20_RS20205	4257350..4257457	+	108	WP_000170926.1	type I toxin-antitoxin system toxin Ldr family protein	-
JJB20_RS20210	4257606..4258460	-	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
JJB20_RS20215	4258496..4259305	-	810	WP_001257044.1	invasion regulator SirB1	-
JJB20_RS20220	4259309..4259701	-	393	WP_000200378.1	invasion regulator SirB2	-
JJB20_RS20225	4259698..4260531	-	834	WP_000456467.1	peptide chain release factor N(5)-glutamine methyltransferase	-
JJB20_RS20230	4260531..4261613	-	1083	WP_000804726.1	peptide chain release factor 1	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4001.77 Da
• Isoelectric Point: 11.4779

>T185805 WP_000170965.1 NZ_CP067232:4256814-4256921 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T185805 NZ_CP089031:c4589623-4589309 [Escherichia coli]
ATGCAATTTACGGTATACCGCAGTCGCAGCAGGAACGCCGCGTTTCCCTTTGTTATCGATGTTACCAGCGACATTATTGG
TGTGATTAATCGCCGTATTGTTATTCCATTAACACCTATTGAACGATTTAGCCGTATTCGCCCACCAGAACGGCTTAACC
CAATCCTTTTACTGGTAGACGGCAAAGAATATGTGCTCATGACGCATGAGACTGCAACTGTTCCAGTTAACGCGCTGGGA
ACGAAATTTTGCGATGCCAGCGCGCACCGAACGTTGATTAAAGGAGCATTAGATTTTATGCTCGACGGGATTTAA

Antitoxin

Nucleotide

• Length: 67 bp

>AT185805 NZ_CP067232:c4256767-4256701 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A0E0Y029

Antitoxin