Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4256701..4256921 | Replicon | chromosome |
| Accession | NZ_CP067232 | ||
| Organism | Escherichia coli strain SBF45 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | JJB20_RS20200 | Protein ID | WP_000170965.1 |
| Coordinates | 4256814..4256921 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4256701..4256767 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JJB20_RS20175 | 4251980..4253374 | - | 1395 | WP_000086212.1 | inverse autotransporter invasin YchO | - |
| JJB20_RS20180 | 4253559..4253912 | + | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
| JJB20_RS20185 | 4253956..4254651 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| JJB20_RS20190 | 4254809..4255039 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| JJB20_RS20195 | 4255309..4256409 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 4256701..4256767 | - | 67 | - | - | Antitoxin |
| JJB20_RS20200 | 4256814..4256921 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4257234..4257297 | - | 64 | NuclAT_32 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_32 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_32 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_32 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_34 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_34 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_34 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_34 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_36 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_36 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_36 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_36 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_38 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_38 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_38 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_38 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_40 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_40 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_40 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_40 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_42 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_42 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_42 | - | - |
| - | 4257234..4257297 | - | 64 | NuclAT_42 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_17 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_17 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_17 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_17 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_19 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_19 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_19 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_19 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_21 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_21 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_21 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_21 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_23 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_23 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_23 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_23 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_28 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_28 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_28 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_28 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_30 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_30 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_30 | - | - |
| - | 4257236..4257297 | - | 62 | NuclAT_30 | - | - |
| JJB20_RS20205 | 4257350..4257457 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| JJB20_RS20210 | 4257606..4258460 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| JJB20_RS20215 | 4258496..4259305 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| JJB20_RS20220 | 4259309..4259701 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| JJB20_RS20225 | 4259698..4260531 | - | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| JJB20_RS20230 | 4260531..4261613 | - | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T185805 WP_000170965.1 NZ_CP067232:4256814-4256921 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T185805 NZ_CP089031:c4589623-4589309 [Escherichia coli]
ATGCAATTTACGGTATACCGCAGTCGCAGCAGGAACGCCGCGTTTCCCTTTGTTATCGATGTTACCAGCGACATTATTGG
TGTGATTAATCGCCGTATTGTTATTCCATTAACACCTATTGAACGATTTAGCCGTATTCGCCCACCAGAACGGCTTAACC
CAATCCTTTTACTGGTAGACGGCAAAGAATATGTGCTCATGACGCATGAGACTGCAACTGTTCCAGTTAACGCGCTGGGA
ACGAAATTTTGCGATGCCAGCGCGCACCGAACGTTGATTAAAGGAGCATTAGATTTTATGCTCGACGGGATTTAA
ATGCAATTTACGGTATACCGCAGTCGCAGCAGGAACGCCGCGTTTCCCTTTGTTATCGATGTTACCAGCGACATTATTGG
TGTGATTAATCGCCGTATTGTTATTCCATTAACACCTATTGAACGATTTAGCCGTATTCGCCCACCAGAACGGCTTAACC
CAATCCTTTTACTGGTAGACGGCAAAGAATATGTGCTCATGACGCATGAGACTGCAACTGTTCCAGTTAACGCGCTGGGA
ACGAAATTTTGCGATGCCAGCGCGCACCGAACGTTGATTAAAGGAGCATTAGATTTTATGCTCGACGGGATTTAA
Antitoxin
Download Length: 67 bp
>AT185805 NZ_CP067232:c4256767-4256701 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|