Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 105688..105941 Replicon plasmid pXHKPN083-2
Accession NZ_CP066912
Organism Klebsiella pneumoniae strain XHKPN083

Toxin (Protein)


Gene name srnB Uniprot ID G9G1E3
Locus tag JG792_RS28620 Protein ID WP_001312851.1
Coordinates 105688..105837 (-) Length 50 a.a.

Antitoxin (RNA)


Gene name srnC
Locus tag -
Coordinates 105882..105941 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JG792_RS28585 (101047) 101047..101462 - 416 Protein_127 IS1 family transposase -
JG792_RS28590 (101711) 101711..102112 - 402 WP_001398199.1 type II toxin-antitoxin system toxin endoribonuclease PemK -
JG792_RS28595 (102045) 102045..102302 - 258 WP_000557619.1 type II toxin-antitoxin system antitoxin PemI -
JG792_RS28600 (102395) 102395..103048 - 654 WP_000616807.1 CPBP family intramembrane metalloprotease -
JG792_RS28605 (103987) 103987..104844 - 858 WP_032495102.1 incFII family plasmid replication initiator RepA -
JG792_RS28610 (104863) 104863..105041 - 179 Protein_132 protein CopA/IncA -
JG792_RS28615 (105156) 105156..105404 - 249 WP_000083837.1 replication regulatory protein RepA -
JG792_RS28620 (105688) 105688..105837 - 150 WP_001312851.1 Hok/Gef family protein Toxin
- (105882) 105882..105941 + 60 NuclAT_1 - Antitoxin
- (105882) 105882..105941 + 60 NuclAT_1 - Antitoxin
- (105882) 105882..105941 + 60 NuclAT_1 - Antitoxin
- (105882) 105882..105941 + 60 NuclAT_1 - Antitoxin
JG792_RS28625 (106142) 106142..106474 - 333 WP_152916585.1 hypothetical protein -
JG792_RS28630 (106536) 106536..107135 - 600 WP_032083981.1 PIN domain-containing protein -
JG792_RS28635 (107521) 107521..107721 - 201 WP_015059022.1 hypothetical protein -
JG792_RS28640 (107853) 107853..108413 - 561 WP_000139328.1 fertility inhibition protein FinO -
JG792_RS28645 (108468) 108468..109214 - 747 WP_000205770.1 conjugal transfer pilus acetylase TraX -
JG792_RS28650 (109234) 109234..109434 - 201 WP_072354025.1 hypothetical protein -
JG792_RS28655 (109459) 109459..110163 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
JG792_RS28660 (110216) 110216..110281 + 66 Protein_142 helix-turn-helix domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid catA2 / blaKPC-2 / rmtB / blaTEM-1B / blaCTX-M-65 - 1..122553 122553


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(4-45)


Sequences

Toxin        


Download         Length: 50 a.a.        Molecular weight: 5542.67 Da        Isoelectric Point: 8.7678

>T185417 WP_001312851.1 NZ_CP066912:c105837-105688 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK

Download         Length: 150 bp

>T185417 NZ_CP088200:635104-635220 [Enterococcus faecalis]
ATGTTTTTGTCCGTTGAAGCAGCGCTAGGACTGATGATTGGTTTTGCAACACTTGTTGTGACCATTATCTTCGGTATCTT
AGCGCTTGTCTTAGACAACAAAAATAACCGTTCATAA

Antitoxin


Download         Length: 60 bp

>AT185417 NZ_CP066912:105882-105941 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829C8K5

Antitoxin

Download structure file

References