Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 45760..46013 | Replicon | plasmid pXHKP502-2 |
| Accession | NZ_CP066906 | ||
| Organism | Klebsiella pneumoniae strain XHKP502 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | JG791_RS28625 | Protein ID | WP_001312851.1 |
| Coordinates | 45760..45909 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 45954..46013 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JG791_RS28590 (41119) | 41119..41534 | - | 416 | Protein_53 | IS1 family transposase | - |
| JG791_RS28595 (41783) | 41783..42184 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| JG791_RS28600 (42117) | 42117..42374 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| JG791_RS28605 (42467) | 42467..43120 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| JG791_RS28610 (44059) | 44059..44916 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| JG791_RS28615 (44935) | 44935..45113 | - | 179 | Protein_58 | protein CopA/IncA | - |
| JG791_RS28620 (45228) | 45228..45476 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| JG791_RS28625 (45760) | 45760..45909 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (45954) | 45954..46013 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (45954) | 45954..46013 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (45954) | 45954..46013 | + | 60 | NuclAT_0 | - | Antitoxin |
| - (45954) | 45954..46013 | + | 60 | NuclAT_0 | - | Antitoxin |
| JG791_RS28630 (46214) | 46214..46546 | - | 333 | WP_152916585.1 | hypothetical protein | - |
| JG791_RS28635 (46608) | 46608..47207 | - | 600 | WP_032083981.1 | PIN domain-containing protein | - |
| JG791_RS28640 (47593) | 47593..47793 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| JG791_RS28645 (47925) | 47925..48485 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| JG791_RS28650 (48540) | 48540..49286 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| JG791_RS28655 (49306) | 49306..49506 | - | 201 | WP_072354025.1 | hypothetical protein | - |
| JG791_RS28660 (49531) | 49531..50235 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| JG791_RS28665 (50287) | 50287..50631 | + | 345 | Protein_68 | IS6-like element IS26 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-2 / blaSHV-12 / blaCTX-M-65 | - | 1..85781 | 85781 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T185387 WP_001312851.1 NZ_CP066906:c45909-45760 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T185387 NZ_CP088157:c1580528-1580283 [Staphylococcus aureus]
ATGAACATTCAAGAAGCAACTAAGATAGCTACAAAAAATCTTGTCTCTATGACACGGAAAGATTGGAAAGAAAGTCATCG
AACTAAGATATTACCAACAAATGATAGTTTTTTACAATGCATCATTTCAAATAGCGATGGGACAAACCTTATCAGATATT
GGCAACCTTCAGCCGATGACCTCATGGCAAATGATTGGGAAGTTATAAACCCAACTAGAGACCAGGAATTATTGAAGCAA
TTTTAG
ATGAACATTCAAGAAGCAACTAAGATAGCTACAAAAAATCTTGTCTCTATGACACGGAAAGATTGGAAAGAAAGTCATCG
AACTAAGATATTACCAACAAATGATAGTTTTTTACAATGCATCATTTCAAATAGCGATGGGACAAACCTTATCAGATATT
GGCAACCTTCAGCCGATGACCTCATGGCAAATGATTGGGAAGTTATAAACCCAACTAGAGACCAGGAATTATTGAAGCAA
TTTTAG
Antitoxin
Download Length: 60 bp
>AT185387 NZ_CP066906:45954-46013 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|