Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 29156..29425 | Replicon | plasmid unnamed1 |
Accession | NZ_CP066807 | ||
Organism | Escherichia coli strain TCM3e1 |
Toxin (Protein)
Gene name | hok | Uniprot ID | P11895 |
Locus tag | JGU77_RS23960 | Protein ID | WP_001312861.1 |
Coordinates | 29267..29425 (+) | Length | 53 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 29156..29221 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
JGU77_RS23930 | 24690..24896 | + | 207 | WP_000275853.1 | hypothetical protein | - |
JGU77_RS23935 | 24922..25461 | + | 540 | WP_097498141.1 | single-stranded DNA-binding protein | - |
JGU77_RS23940 | 25524..25758 | + | 235 | Protein_32 | DUF905 family protein | - |
JGU77_RS23945 | 25824..27782 | + | 1959 | WP_000117163.1 | ParB/RepB/Spo0J family partition protein | - |
JGU77_RS23950 | 27837..28271 | + | 435 | WP_000845953.1 | conjugation system SOS inhibitor PsiB | - |
JGU77_RS23955 | 28268..28987 | + | 720 | WP_001276217.1 | plasmid SOS inhibition protein A | - |
- | 28999..29223 | + | 225 | NuclAT_0 | - | - |
- | 28999..29223 | + | 225 | NuclAT_0 | - | - |
- | 28999..29223 | + | 225 | NuclAT_0 | - | - |
- | 28999..29223 | + | 225 | NuclAT_0 | - | - |
- | 29156..29221 | - | 66 | - | - | Antitoxin |
JGU77_RS23960 | 29267..29425 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
JGU77_RS23965 | 29726..29930 | - | 205 | Protein_37 | pilus protein | - |
JGU77_RS23970 | 30322..30618 | + | 297 | WP_001272251.1 | hypothetical protein | - |
JGU77_RS23975 | 30729..31550 | + | 822 | WP_001234445.1 | DUF945 domain-containing protein | - |
JGU77_RS23980 | 31847..32437 | - | 591 | WP_000252683.1 | transglycosylase SLT domain-containing protein | - |
JGU77_RS23985 | 32770..33153 | + | 384 | WP_001151529.1 | relaxosome protein TraM | - |
JGU77_RS23990 | 33345..33992 | + | 648 | WP_000332523.1 | transcriptional regulator TraJ family protein | - |
JGU77_RS23995 | 34100..34339 | + | 240 | WP_042018283.1 | conjugal transfer relaxosome protein TraY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1C | - | 1..131861 | 131861 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T185091 WP_001312861.1 NZ_CP066807:29267-29425 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T185091 NZ_CP087993:c475640-475386 [Xylella fastidiosa subsp. multiplex]
ATGAAGCGTAAGCACGCTAAAACTCTCAGCGCTATATACACACGCCCTGTTTCGGCCAACATTCAATGGCGCGATATTGA
AGCGCTGTTCGTGGAGCTTGGAGCGAAAGTAGAAGAACGTGAAGGTTCTCGTATGTTGGTGCGGCTGTTCGGTGAACGTC
GGATATTCCACCGGCCCCACCCTTCGCCTAACACTGACAAGGGTGCTGTTGAATCAATCCGAGCTTGGTTGAAATCGAAC
GGAGTTACACCATGA
ATGAAGCGTAAGCACGCTAAAACTCTCAGCGCTATATACACACGCCCTGTTTCGGCCAACATTCAATGGCGCGATATTGA
AGCGCTGTTCGTGGAGCTTGGAGCGAAAGTAGAAGAACGTGAAGGTTCTCGTATGTTGGTGCGGCTGTTCGGTGAACGTC
GGATATTCCACCGGCCCCACCCTTCGCCTAACACTGACAAGGGTGCTGTTGAATCAATCCGAGCTTGGTTGAAATCGAAC
GGAGTTACACCATGA
Antitoxin
Download Length: 66 bp
>AT185091 NZ_CP066807:c29221-29156 [Escherichia coli]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|