Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2258718..2258938 Replicon chromosome
Accession NZ_CP066806
Organism Escherichia coli strain TCM3e1

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag JGU77_RS10855 Protein ID WP_000170954.1
Coordinates 2258718..2258825 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2258875..2258938 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JGU77_RS10830 2254562..2255644 + 1083 WP_000804726.1 peptide chain release factor 1 -
JGU77_RS10835 2255644..2256477 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
JGU77_RS10840 2256474..2256866 + 393 WP_000200374.1 invasion regulator SirB2 -
JGU77_RS10845 2256870..2257679 + 810 WP_001257044.1 invasion regulator SirB1 -
JGU77_RS10850 2257715..2258569 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JGU77_RS10855 2258718..2258825 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2258875..2258938 + 64 NuclAT_49 - Antitoxin
- 2258875..2258938 + 64 NuclAT_49 - Antitoxin
- 2258875..2258938 + 64 NuclAT_49 - Antitoxin
- 2258875..2258938 + 64 NuclAT_49 - Antitoxin
- 2258875..2258938 + 64 NuclAT_52 - Antitoxin
- 2258875..2258938 + 64 NuclAT_52 - Antitoxin
- 2258875..2258938 + 64 NuclAT_52 - Antitoxin
- 2258875..2258938 + 64 NuclAT_52 - Antitoxin
- 2258875..2258938 + 64 NuclAT_55 - Antitoxin
- 2258875..2258938 + 64 NuclAT_55 - Antitoxin
- 2258875..2258938 + 64 NuclAT_55 - Antitoxin
- 2258875..2258938 + 64 NuclAT_55 - Antitoxin
- 2258875..2258938 + 64 NuclAT_58 - Antitoxin
- 2258875..2258938 + 64 NuclAT_58 - Antitoxin
- 2258875..2258938 + 64 NuclAT_58 - Antitoxin
- 2258875..2258938 + 64 NuclAT_58 - Antitoxin
- 2258875..2258938 + 64 NuclAT_61 - Antitoxin
- 2258875..2258938 + 64 NuclAT_61 - Antitoxin
- 2258875..2258938 + 64 NuclAT_61 - Antitoxin
- 2258875..2258938 + 64 NuclAT_61 - Antitoxin
JGU77_RS10860 2259253..2259360 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2259413..2259474 + 62 NuclAT_48 - -
- 2259413..2259474 + 62 NuclAT_48 - -
- 2259413..2259474 + 62 NuclAT_48 - -
- 2259413..2259474 + 62 NuclAT_48 - -
- 2259413..2259474 + 62 NuclAT_51 - -
- 2259413..2259474 + 62 NuclAT_51 - -
- 2259413..2259474 + 62 NuclAT_51 - -
- 2259413..2259474 + 62 NuclAT_51 - -
- 2259413..2259474 + 62 NuclAT_54 - -
- 2259413..2259474 + 62 NuclAT_54 - -
- 2259413..2259474 + 62 NuclAT_54 - -
- 2259413..2259474 + 62 NuclAT_54 - -
- 2259413..2259474 + 62 NuclAT_57 - -
- 2259413..2259474 + 62 NuclAT_57 - -
- 2259413..2259474 + 62 NuclAT_57 - -
- 2259413..2259474 + 62 NuclAT_57 - -
- 2259413..2259474 + 62 NuclAT_60 - -
- 2259413..2259474 + 62 NuclAT_60 - -
- 2259413..2259474 + 62 NuclAT_60 - -
- 2259413..2259474 + 62 NuclAT_60 - -
- 2259413..2259476 + 64 NuclAT_12 - -
- 2259413..2259476 + 64 NuclAT_12 - -
- 2259413..2259476 + 64 NuclAT_12 - -
- 2259413..2259476 + 64 NuclAT_12 - -
- 2259413..2259476 + 64 NuclAT_14 - -
- 2259413..2259476 + 64 NuclAT_14 - -
- 2259413..2259476 + 64 NuclAT_14 - -
- 2259413..2259476 + 64 NuclAT_14 - -
- 2259413..2259476 + 64 NuclAT_16 - -
- 2259413..2259476 + 64 NuclAT_16 - -
- 2259413..2259476 + 64 NuclAT_16 - -
- 2259413..2259476 + 64 NuclAT_16 - -
- 2259413..2259476 + 64 NuclAT_18 - -
- 2259413..2259476 + 64 NuclAT_18 - -
- 2259413..2259476 + 64 NuclAT_18 - -
- 2259413..2259476 + 64 NuclAT_18 - -
- 2259413..2259476 + 64 NuclAT_20 - -
- 2259413..2259476 + 64 NuclAT_20 - -
- 2259413..2259476 + 64 NuclAT_20 - -
- 2259413..2259476 + 64 NuclAT_20 - -
- 2259413..2259476 + 64 NuclAT_22 - -
- 2259413..2259476 + 64 NuclAT_22 - -
- 2259413..2259476 + 64 NuclAT_22 - -
- 2259413..2259476 + 64 NuclAT_22 - -
JGU77_RS10865 2259789..2259896 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2259944..2260009 + 66 NuclAT_47 - -
- 2259944..2260009 + 66 NuclAT_47 - -
- 2259944..2260009 + 66 NuclAT_47 - -
- 2259944..2260009 + 66 NuclAT_47 - -
- 2259944..2260009 + 66 NuclAT_50 - -
- 2259944..2260009 + 66 NuclAT_50 - -
- 2259944..2260009 + 66 NuclAT_50 - -
- 2259944..2260009 + 66 NuclAT_50 - -
- 2259944..2260009 + 66 NuclAT_53 - -
- 2259944..2260009 + 66 NuclAT_53 - -
- 2259944..2260009 + 66 NuclAT_53 - -
- 2259944..2260009 + 66 NuclAT_53 - -
- 2259944..2260009 + 66 NuclAT_56 - -
- 2259944..2260009 + 66 NuclAT_56 - -
- 2259944..2260009 + 66 NuclAT_56 - -
- 2259944..2260009 + 66 NuclAT_56 - -
- 2259944..2260009 + 66 NuclAT_59 - -
- 2259944..2260009 + 66 NuclAT_59 - -
- 2259944..2260009 + 66 NuclAT_59 - -
- 2259944..2260009 + 66 NuclAT_59 - -
- 2259944..2260011 + 68 NuclAT_11 - -
- 2259944..2260011 + 68 NuclAT_11 - -
- 2259944..2260011 + 68 NuclAT_11 - -
- 2259944..2260011 + 68 NuclAT_11 - -
- 2259944..2260011 + 68 NuclAT_13 - -
- 2259944..2260011 + 68 NuclAT_13 - -
- 2259944..2260011 + 68 NuclAT_13 - -
- 2259944..2260011 + 68 NuclAT_13 - -
- 2259944..2260011 + 68 NuclAT_15 - -
- 2259944..2260011 + 68 NuclAT_15 - -
- 2259944..2260011 + 68 NuclAT_15 - -
- 2259944..2260011 + 68 NuclAT_15 - -
- 2259944..2260011 + 68 NuclAT_17 - -
- 2259944..2260011 + 68 NuclAT_17 - -
- 2259944..2260011 + 68 NuclAT_17 - -
- 2259944..2260011 + 68 NuclAT_17 - -
- 2259944..2260011 + 68 NuclAT_19 - -
- 2259944..2260011 + 68 NuclAT_19 - -
- 2259944..2260011 + 68 NuclAT_19 - -
- 2259944..2260011 + 68 NuclAT_19 - -
- 2259944..2260011 + 68 NuclAT_21 - -
- 2259944..2260011 + 68 NuclAT_21 - -
- 2259944..2260011 + 68 NuclAT_21 - -
- 2259944..2260011 + 68 NuclAT_21 - -
JGU77_RS10870 2260301..2261401 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
JGU77_RS10875 2261671..2261901 + 231 WP_001146442.1 putative cation transport regulator ChaB -
JGU77_RS10880 2262059..2262754 + 696 WP_012311798.1 glutathione-specific gamma-glutamylcyclotransferase -
JGU77_RS10885 2262798..2263151 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T185067 WP_000170954.1 NZ_CP066806:c2258825-2258718 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T185067 NZ_CP087957:c1234549-1233803 [Bacillus velezensis]
ATGCTTTTGTTTTTTCAGATCATGGTGTGGACGATGGCGGCCGCACTCATTTTATATGTGTACGCATCCTGGCGGTATGA
GGCAAAGGTAAAAGAAAAAATGTTTGCCATCCGTAAAACGTGGTATTTACTATTTGTAGTAGGCGCCATGGTCTATTGGA
CATATGATCCCGAATCGCTCTTTGCCGCATGGAGACAATATTTGATTGTTGCCGTCTGCTTTGCCCTTATTGATGCGTTT
ATCTTTTTGAGCGCGTATATCAAAAAGCTCGCCGGCAATGAATTAGAGACGGATACGCGGGAAATTTTAGAAGAAAATAA
CGAAATGCTTCACTCCTATCTTGAAAAACTGAAAACCTATCAATATCTGTTGAAAAATGAACCGATCCATGTATATTATG
GAAGTACAGAAGCTTATGCGGAAGGCATCAGCAGACTGCTGGCCGCTTATGGAGAAAAAATGAATGTCACGGCTTCCTTG
TGCGACTATTCCGCACAATCGGATAAGGACCGCTTGACGGAGCATATGCCTGATGCGGCGGACGTTCAGTCCCGTCTTAA
CCGTAAAGACGTCTACTATGATCAAAAAGGCAGGCTTGTGCTTATTCCGTTTACAGTCCAGGACCGCCATTACGTGATCA
AACTCACGTCGGAAAACCTGTTGACGGAATTCGATTATTTGCTTTTCACATCGCTAACGAGCATTTATGATTTAATGCTG
CCAATAGAAGAGGAAGGTGACGGTTAA

Antitoxin


Download         Length: 64 bp

>AT185067 NZ_CP066806:2258875-2258938 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References