Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 104898..105151 | Replicon | plasmid pKPC2_090361 |
Accession | NZ_CP066529 | ||
Organism | Klebsiella pneumoniae strain WCHKP090361 |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | H3G66_RS27155 | Protein ID | WP_001312851.1 |
Coordinates | 105002..105151 (+) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 104898..104957 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
H3G66_RS27115 | 100558..100623 | - | 66 | Protein_132 | helix-turn-helix domain-containing protein | - |
H3G66_RS27120 | 100676..101380 | - | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
H3G66_RS27125 | 101444..101605 | + | 162 | Protein_134 | DNA helicase | - |
H3G66_RS27130 | 101625..102371 | + | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
H3G66_RS27135 | 102426..102986 | + | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
H3G66_RS27140 | 103118..103318 | + | 201 | WP_015059022.1 | hypothetical protein | - |
H3G66_RS27145 | 103704..104303 | + | 600 | WP_032083981.1 | hypothetical protein | - |
H3G66_RS27150 | 104467..104697 | + | 231 | WP_001736714.1 | hypothetical protein | - |
- | 104898..104957 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 104898..104957 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 104898..104957 | - | 60 | NuclAT_1 | - | Antitoxin |
- | 104898..104957 | - | 60 | NuclAT_1 | - | Antitoxin |
H3G66_RS27155 | 105002..105151 | + | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
H3G66_RS27160 | 105435..105683 | + | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
H3G66_RS27165 | 105928..106002 | + | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
H3G66_RS27170 | 105995..106852 | + | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
H3G66_RS27175 | 107791..108444 | + | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
H3G66_RS27180 | 108537..108794 | + | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
H3G66_RS27185 | 108727..109128 | + | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
H3G66_RS27190 | 109377..109792 | + | 416 | Protein_147 | IS1 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | blaKPC-2 / rmtB / blaTEM-1B / blaCTX-M-65 / fosA3 | - | 1..144228 | 144228 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T184583 WP_001312851.1 NZ_CP066529:105002-105151 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T184583 NZ_CP087691:c450975-450772 [Xylella taiwanensis]
ATGACGTTGCCGCTTCACTGGCGTACATCCGCACGCGATGACTTGGCCTCGTTGATACGTTTCATCGCTTACGAAAATCC
GCTTACCGCGCGGCGCATGAAAGTACTCATTGAAGCGTCCGTGTTACTAGCCTCCGCACATCCCTACATGTTCCGACCTG
GCCGTGTACCAGGGACACGAGAGATCGTGGCCCACCCGAACTAG
ATGACGTTGCCGCTTCACTGGCGTACATCCGCACGCGATGACTTGGCCTCGTTGATACGTTTCATCGCTTACGAAAATCC
GCTTACCGCGCGGCGCATGAAAGTACTCATTGAAGCGTCCGTGTTACTAGCCTCCGCACATCCCTACATGTTCCGACCTG
GCCGTGTACCAGGGACACGAGAGATCGTGGCCCACCCGAACTAG
Antitoxin
Download Length: 60 bp
>AT184583 NZ_CP066529:c104957-104898 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|