Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-sokC/Ldr(toxin)
Location 870932..871151 Replicon chromosome
Accession NZ_CP066085
Organism Escherichia fergusonii strain FDAARGOS_1032

Toxin (Protein)


Gene name ldrD Uniprot ID S1NWX0
Locus tag I6H89_RS04240 Protein ID WP_001295224.1
Coordinates 870932..871039 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokC
Locus tag -
Coordinates 871088..871151 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6H89_RS04210 865975..867534 + 1560 WP_001070267.1 cellulose biosynthesis protein BcsE -
I6H89_RS04215 867531..867722 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
I6H89_RS04220 867719..869398 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
I6H89_RS04225 869485..869592 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 869650..869704 + 55 NuclAT_19 - -
- 869650..869704 + 55 NuclAT_19 - -
- 869650..869704 + 55 NuclAT_19 - -
- 869650..869704 + 55 NuclAT_19 - -
- 869650..869704 + 55 NuclAT_21 - -
- 869650..869704 + 55 NuclAT_21 - -
- 869650..869704 + 55 NuclAT_21 - -
- 869650..869704 + 55 NuclAT_21 - -
- 869650..869704 + 55 NuclAT_23 - -
- 869650..869704 + 55 NuclAT_23 - -
- 869650..869704 + 55 NuclAT_23 - -
- 869650..869704 + 55 NuclAT_23 - -
- 869650..869704 + 55 NuclAT_25 - -
- 869650..869704 + 55 NuclAT_25 - -
- 869650..869704 + 55 NuclAT_25 - -
- 869650..869704 + 55 NuclAT_25 - -
- 869650..869706 + 57 NuclAT_12 - -
- 869650..869706 + 57 NuclAT_12 - -
- 869650..869706 + 57 NuclAT_12 - -
- 869650..869706 + 57 NuclAT_12 - -
- 869650..869706 + 57 NuclAT_14 - -
- 869650..869706 + 57 NuclAT_14 - -
- 869650..869706 + 57 NuclAT_14 - -
- 869650..869706 + 57 NuclAT_14 - -
I6H89_RS04230 869967..870074 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
I6H89_RS04235 870449..870556 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
I6H89_RS04240 870932..871039 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 871088..871151 + 64 NuclAT_18 - Antitoxin
- 871088..871151 + 64 NuclAT_18 - Antitoxin
- 871088..871151 + 64 NuclAT_18 - Antitoxin
- 871088..871151 + 64 NuclAT_18 - Antitoxin
- 871088..871151 + 64 NuclAT_20 - Antitoxin
- 871088..871151 + 64 NuclAT_20 - Antitoxin
- 871088..871151 + 64 NuclAT_20 - Antitoxin
- 871088..871151 + 64 NuclAT_20 - Antitoxin
- 871088..871151 + 64 NuclAT_22 - Antitoxin
- 871088..871151 + 64 NuclAT_22 - Antitoxin
- 871088..871151 + 64 NuclAT_22 - Antitoxin
- 871088..871151 + 64 NuclAT_22 - Antitoxin
- 871088..871151 + 64 NuclAT_24 - Antitoxin
- 871088..871151 + 64 NuclAT_24 - Antitoxin
- 871088..871151 + 64 NuclAT_24 - Antitoxin
- 871088..871151 + 64 NuclAT_24 - Antitoxin
- 871088..871153 + 66 NuclAT_11 - -
- 871088..871153 + 66 NuclAT_11 - -
- 871088..871153 + 66 NuclAT_11 - -
- 871088..871153 + 66 NuclAT_11 - -
- 871088..871153 + 66 NuclAT_13 - -
- 871088..871153 + 66 NuclAT_13 - -
- 871088..871153 + 66 NuclAT_13 - -
- 871088..871153 + 66 NuclAT_13 - -
I6H89_RS04245 871475..872671 + 1197 WP_001016304.1 methionine gamma-lyase -
I6H89_RS04250 872921..874219 + 1299 WP_001152710.1 amino acid permease -
I6H89_RS04255 874235..875446 - 1212 WP_024256550.1 sigma 54-interacting transcriptional regulator -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3882.70 Da        Isoelectric Point: 9.0157

>T183881 WP_001295224.1 NZ_CP066085:c871039-870932 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Download         Length: 108 bp

>T183881 NZ_CP087200:c1579745-1579530 [Pseudomonas viciae]
GTGAATAGCCGATTTCTGATAAGCCAAATTATTGCGGACGGTGGGTATCTGGTGCGGGTTCGGGGCAGTCACCATCACTT
CAAGCATCCGACCAAGCCGGGGCTGGTGACGGTACCCCATCCAAAGAAGGACCTGCTCAAAAAAACGGCCATCAGTATTT
TGCAACAGGCGCTGCTTCAGACGGCCAGTTGCGCTACGTCTGCGGAGGACGATTGA

Antitoxin


Download         Length: 64 bp

>AT183881 NZ_CP066085:871088-871151 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A4P7TSJ7


Antitoxin

Download structure file

References