Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4155647..4155867 Replicon chromosome
Accession NZ_CP066032
Organism Escherichia coli strain FDAARGOS_1059

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag I6I16_RS20475 Protein ID WP_000170965.1
Coordinates 4155760..4155867 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4155647..4155713 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6I16_RS20450 4150926..4152320 - 1395 WP_000086212.1 inverse autotransporter invasin YchO -
I6I16_RS20455 4152505..4152858 + 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
I6I16_RS20460 4152902..4153597 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
I6I16_RS20465 4153755..4153985 - 231 WP_001146441.1 putative cation transport regulator ChaB -
I6I16_RS20470 4154255..4155355 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 4155647..4155713 - 67 - - Antitoxin
I6I16_RS20475 4155760..4155867 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4156180..4156243 - 64 NuclAT_33 - -
- 4156180..4156243 - 64 NuclAT_33 - -
- 4156180..4156243 - 64 NuclAT_33 - -
- 4156180..4156243 - 64 NuclAT_33 - -
- 4156180..4156243 - 64 NuclAT_35 - -
- 4156180..4156243 - 64 NuclAT_35 - -
- 4156180..4156243 - 64 NuclAT_35 - -
- 4156180..4156243 - 64 NuclAT_35 - -
- 4156180..4156243 - 64 NuclAT_37 - -
- 4156180..4156243 - 64 NuclAT_37 - -
- 4156180..4156243 - 64 NuclAT_37 - -
- 4156180..4156243 - 64 NuclAT_37 - -
- 4156180..4156243 - 64 NuclAT_39 - -
- 4156180..4156243 - 64 NuclAT_39 - -
- 4156180..4156243 - 64 NuclAT_39 - -
- 4156180..4156243 - 64 NuclAT_39 - -
- 4156180..4156243 - 64 NuclAT_41 - -
- 4156180..4156243 - 64 NuclAT_41 - -
- 4156180..4156243 - 64 NuclAT_41 - -
- 4156180..4156243 - 64 NuclAT_41 - -
- 4156180..4156243 - 64 NuclAT_43 - -
- 4156180..4156243 - 64 NuclAT_43 - -
- 4156180..4156243 - 64 NuclAT_43 - -
- 4156180..4156243 - 64 NuclAT_43 - -
- 4156181..4156243 - 63 NuclAT_45 - -
- 4156181..4156243 - 63 NuclAT_45 - -
- 4156181..4156243 - 63 NuclAT_45 - -
- 4156181..4156243 - 63 NuclAT_45 - -
- 4156181..4156243 - 63 NuclAT_48 - -
- 4156181..4156243 - 63 NuclAT_48 - -
- 4156181..4156243 - 63 NuclAT_48 - -
- 4156181..4156243 - 63 NuclAT_48 - -
- 4156182..4156243 - 62 NuclAT_15 - -
- 4156182..4156243 - 62 NuclAT_15 - -
- 4156182..4156243 - 62 NuclAT_15 - -
- 4156182..4156243 - 62 NuclAT_15 - -
- 4156182..4156243 - 62 NuclAT_18 - -
- 4156182..4156243 - 62 NuclAT_18 - -
- 4156182..4156243 - 62 NuclAT_18 - -
- 4156182..4156243 - 62 NuclAT_18 - -
- 4156182..4156243 - 62 NuclAT_21 - -
- 4156182..4156243 - 62 NuclAT_21 - -
- 4156182..4156243 - 62 NuclAT_21 - -
- 4156182..4156243 - 62 NuclAT_21 - -
- 4156182..4156243 - 62 NuclAT_24 - -
- 4156182..4156243 - 62 NuclAT_24 - -
- 4156182..4156243 - 62 NuclAT_24 - -
- 4156182..4156243 - 62 NuclAT_24 - -
- 4156182..4156243 - 62 NuclAT_27 - -
- 4156182..4156243 - 62 NuclAT_27 - -
- 4156182..4156243 - 62 NuclAT_27 - -
- 4156182..4156243 - 62 NuclAT_27 - -
- 4156182..4156243 - 62 NuclAT_30 - -
- 4156182..4156243 - 62 NuclAT_30 - -
- 4156182..4156243 - 62 NuclAT_30 - -
- 4156182..4156243 - 62 NuclAT_30 - -
I6I16_RS20480 4156296..4156403 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4156717..4156783 - 67 NuclAT_44 - -
- 4156717..4156783 - 67 NuclAT_44 - -
- 4156717..4156783 - 67 NuclAT_44 - -
- 4156717..4156783 - 67 NuclAT_44 - -
- 4156717..4156783 - 67 NuclAT_47 - -
- 4156717..4156783 - 67 NuclAT_47 - -
- 4156717..4156783 - 67 NuclAT_47 - -
- 4156717..4156783 - 67 NuclAT_47 - -
- 4156718..4156781 - 64 NuclAT_16 - -
- 4156718..4156781 - 64 NuclAT_16 - -
- 4156718..4156781 - 64 NuclAT_16 - -
- 4156718..4156781 - 64 NuclAT_16 - -
- 4156718..4156781 - 64 NuclAT_19 - -
- 4156718..4156781 - 64 NuclAT_19 - -
- 4156718..4156781 - 64 NuclAT_19 - -
- 4156718..4156781 - 64 NuclAT_19 - -
- 4156718..4156781 - 64 NuclAT_22 - -
- 4156718..4156781 - 64 NuclAT_22 - -
- 4156718..4156781 - 64 NuclAT_22 - -
- 4156718..4156781 - 64 NuclAT_22 - -
- 4156718..4156781 - 64 NuclAT_25 - -
- 4156718..4156781 - 64 NuclAT_25 - -
- 4156718..4156781 - 64 NuclAT_25 - -
- 4156718..4156781 - 64 NuclAT_25 - -
- 4156718..4156781 - 64 NuclAT_28 - -
- 4156718..4156781 - 64 NuclAT_28 - -
- 4156718..4156781 - 64 NuclAT_28 - -
- 4156718..4156781 - 64 NuclAT_28 - -
- 4156718..4156781 - 64 NuclAT_31 - -
- 4156718..4156781 - 64 NuclAT_31 - -
- 4156718..4156781 - 64 NuclAT_31 - -
- 4156718..4156781 - 64 NuclAT_31 - -
I6I16_RS20485 4156831..4156938 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
I6I16_RS20490 4157087..4157941 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6I16_RS20495 4157977..4158786 - 810 WP_001257044.1 invasion regulator SirB1 -
I6I16_RS20500 4158790..4159182 - 393 WP_000200392.1 invasion regulator SirB2 -
I6I16_RS20505 4159179..4160012 - 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T183813 WP_000170965.1 NZ_CP066032:4155760-4155867 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T183813 NZ_CP087186:3304198-3304419 [Pseudomonas siliginis]
ATCGAATACGTAGAACAACGCAACACTGTCGCTTCAGTTGCACTGCACCAAAGGCTCAGCGCCGCAGCGCGAAGGCTTTC
CTGGATACCGCATGGTTTCCGCTCCGGCCGAATACCGGGCACTCGCGAAATGGTCATCAACTCGAATTATTTACTGGTCT
ATCAGGTGACAGACCACATCAAAATTCTGACGGTGTTGCACGCCCGTAAAAAATATCCATAA

Antitoxin


Download         Length: 67 bp

>AT183813 NZ_CP066032:c4155713-4155647 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References