Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4915893..4916114 Replicon chromosome
Accession NZ_CP065611
Organism Escherichia coli strain FDAARGOS_945

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag I6H02_RS25405 Protein ID WP_000170954.1
Coordinates 4915893..4916000 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4916048..4916114 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6H02_RS25380 4911737..4912819 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6H02_RS25385 4912819..4913652 + 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6H02_RS25390 4913649..4914041 + 393 WP_000200363.1 invasion regulator SirB2 -
I6H02_RS25395 4914045..4914854 + 810 WP_001257044.1 invasion regulator SirB1 -
I6H02_RS25400 4914890..4915744 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6H02_RS25405 4915893..4916000 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4916048..4916114 + 67 NuclAT_25 - Antitoxin
- 4916048..4916114 + 67 NuclAT_25 - Antitoxin
- 4916048..4916114 + 67 NuclAT_25 - Antitoxin
- 4916048..4916114 + 67 NuclAT_25 - Antitoxin
- 4916048..4916114 + 67 NuclAT_27 - Antitoxin
- 4916048..4916114 + 67 NuclAT_27 - Antitoxin
- 4916048..4916114 + 67 NuclAT_27 - Antitoxin
- 4916048..4916114 + 67 NuclAT_27 - Antitoxin
- 4916048..4916114 + 67 NuclAT_29 - Antitoxin
- 4916048..4916114 + 67 NuclAT_29 - Antitoxin
- 4916048..4916114 + 67 NuclAT_29 - Antitoxin
- 4916048..4916114 + 67 NuclAT_29 - Antitoxin
- 4916048..4916114 + 67 NuclAT_31 - Antitoxin
- 4916048..4916114 + 67 NuclAT_31 - Antitoxin
- 4916048..4916114 + 67 NuclAT_31 - Antitoxin
- 4916048..4916114 + 67 NuclAT_31 - Antitoxin
- 4916048..4916114 + 67 NuclAT_33 - Antitoxin
- 4916048..4916114 + 67 NuclAT_33 - Antitoxin
- 4916048..4916114 + 67 NuclAT_33 - Antitoxin
- 4916048..4916114 + 67 NuclAT_33 - Antitoxin
- 4916048..4916114 + 67 NuclAT_35 - Antitoxin
- 4916048..4916114 + 67 NuclAT_35 - Antitoxin
- 4916048..4916114 + 67 NuclAT_35 - Antitoxin
- 4916048..4916114 + 67 NuclAT_35 - Antitoxin
- 4916050..4916113 + 64 NuclAT_39 - -
- 4916050..4916113 + 64 NuclAT_39 - -
- 4916050..4916113 + 64 NuclAT_39 - -
- 4916050..4916113 + 64 NuclAT_39 - -
- 4916050..4916113 + 64 NuclAT_42 - -
- 4916050..4916113 + 64 NuclAT_42 - -
- 4916050..4916113 + 64 NuclAT_42 - -
- 4916050..4916113 + 64 NuclAT_42 - -
- 4916050..4916113 + 64 NuclAT_45 - -
- 4916050..4916113 + 64 NuclAT_45 - -
- 4916050..4916113 + 64 NuclAT_45 - -
- 4916050..4916113 + 64 NuclAT_45 - -
I6H02_RS25410 4916428..4916535 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4916588..4916649 + 62 NuclAT_38 - -
- 4916588..4916649 + 62 NuclAT_38 - -
- 4916588..4916649 + 62 NuclAT_38 - -
- 4916588..4916649 + 62 NuclAT_38 - -
- 4916588..4916649 + 62 NuclAT_41 - -
- 4916588..4916649 + 62 NuclAT_41 - -
- 4916588..4916649 + 62 NuclAT_41 - -
- 4916588..4916649 + 62 NuclAT_41 - -
- 4916588..4916649 + 62 NuclAT_44 - -
- 4916588..4916649 + 62 NuclAT_44 - -
- 4916588..4916649 + 62 NuclAT_44 - -
- 4916588..4916649 + 62 NuclAT_44 - -
- 4916588..4916650 + 63 NuclAT_26 - -
- 4916588..4916650 + 63 NuclAT_26 - -
- 4916588..4916650 + 63 NuclAT_26 - -
- 4916588..4916650 + 63 NuclAT_26 - -
- 4916588..4916650 + 63 NuclAT_28 - -
- 4916588..4916650 + 63 NuclAT_28 - -
- 4916588..4916650 + 63 NuclAT_28 - -
- 4916588..4916650 + 63 NuclAT_28 - -
- 4916588..4916650 + 63 NuclAT_30 - -
- 4916588..4916650 + 63 NuclAT_30 - -
- 4916588..4916650 + 63 NuclAT_30 - -
- 4916588..4916650 + 63 NuclAT_30 - -
- 4916588..4916650 + 63 NuclAT_32 - -
- 4916588..4916650 + 63 NuclAT_32 - -
- 4916588..4916650 + 63 NuclAT_32 - -
- 4916588..4916650 + 63 NuclAT_32 - -
- 4916588..4916650 + 63 NuclAT_34 - -
- 4916588..4916650 + 63 NuclAT_34 - -
- 4916588..4916650 + 63 NuclAT_34 - -
- 4916588..4916650 + 63 NuclAT_34 - -
- 4916588..4916650 + 63 NuclAT_36 - -
- 4916588..4916650 + 63 NuclAT_36 - -
- 4916588..4916650 + 63 NuclAT_36 - -
- 4916588..4916650 + 63 NuclAT_36 - -
- 4916588..4916651 + 64 NuclAT_14 - -
- 4916588..4916651 + 64 NuclAT_14 - -
- 4916588..4916651 + 64 NuclAT_14 - -
- 4916588..4916651 + 64 NuclAT_14 - -
- 4916588..4916651 + 64 NuclAT_16 - -
- 4916588..4916651 + 64 NuclAT_16 - -
- 4916588..4916651 + 64 NuclAT_16 - -
- 4916588..4916651 + 64 NuclAT_16 - -
- 4916588..4916651 + 64 NuclAT_18 - -
- 4916588..4916651 + 64 NuclAT_18 - -
- 4916588..4916651 + 64 NuclAT_18 - -
- 4916588..4916651 + 64 NuclAT_18 - -
- 4916588..4916651 + 64 NuclAT_20 - -
- 4916588..4916651 + 64 NuclAT_20 - -
- 4916588..4916651 + 64 NuclAT_20 - -
- 4916588..4916651 + 64 NuclAT_20 - -
- 4916588..4916651 + 64 NuclAT_22 - -
- 4916588..4916651 + 64 NuclAT_22 - -
- 4916588..4916651 + 64 NuclAT_22 - -
- 4916588..4916651 + 64 NuclAT_22 - -
- 4916588..4916651 + 64 NuclAT_24 - -
- 4916588..4916651 + 64 NuclAT_24 - -
- 4916588..4916651 + 64 NuclAT_24 - -
- 4916588..4916651 + 64 NuclAT_24 - -
I6H02_RS25415 4916964..4917071 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4917119..4917184 + 66 NuclAT_37 - -
- 4917119..4917184 + 66 NuclAT_37 - -
- 4917119..4917184 + 66 NuclAT_37 - -
- 4917119..4917184 + 66 NuclAT_37 - -
- 4917119..4917184 + 66 NuclAT_40 - -
- 4917119..4917184 + 66 NuclAT_40 - -
- 4917119..4917184 + 66 NuclAT_40 - -
- 4917119..4917184 + 66 NuclAT_40 - -
- 4917119..4917184 + 66 NuclAT_43 - -
- 4917119..4917184 + 66 NuclAT_43 - -
- 4917119..4917184 + 66 NuclAT_43 - -
- 4917119..4917184 + 66 NuclAT_43 - -
- 4917119..4917186 + 68 NuclAT_13 - -
- 4917119..4917186 + 68 NuclAT_13 - -
- 4917119..4917186 + 68 NuclAT_13 - -
- 4917119..4917186 + 68 NuclAT_13 - -
- 4917119..4917186 + 68 NuclAT_15 - -
- 4917119..4917186 + 68 NuclAT_15 - -
- 4917119..4917186 + 68 NuclAT_15 - -
- 4917119..4917186 + 68 NuclAT_15 - -
- 4917119..4917186 + 68 NuclAT_17 - -
- 4917119..4917186 + 68 NuclAT_17 - -
- 4917119..4917186 + 68 NuclAT_17 - -
- 4917119..4917186 + 68 NuclAT_17 - -
- 4917119..4917186 + 68 NuclAT_19 - -
- 4917119..4917186 + 68 NuclAT_19 - -
- 4917119..4917186 + 68 NuclAT_19 - -
- 4917119..4917186 + 68 NuclAT_19 - -
- 4917119..4917186 + 68 NuclAT_21 - -
- 4917119..4917186 + 68 NuclAT_21 - -
- 4917119..4917186 + 68 NuclAT_21 - -
- 4917119..4917186 + 68 NuclAT_21 - -
- 4917119..4917186 + 68 NuclAT_23 - -
- 4917119..4917186 + 68 NuclAT_23 - -
- 4917119..4917186 + 68 NuclAT_23 - -
- 4917119..4917186 + 68 NuclAT_23 - -
I6H02_RS25420 4917476..4918576 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
I6H02_RS25425 4918846..4919076 + 231 WP_001146440.1 putative cation transport regulator ChaB -
I6H02_RS25430 4919234..4919929 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
I6H02_RS25435 4919973..4920326 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T182999 WP_000170954.1 NZ_CP065611:c4916000-4915893 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T182999 NZ_CP086625:264075-264182 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT182999 NZ_CP065611:4916048-4916114 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References