Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 4915893..4916114 | Replicon | chromosome |
| Accession | NZ_CP065611 | ||
| Organism | Escherichia coli strain FDAARGOS_945 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | I6H02_RS25405 | Protein ID | WP_000170954.1 |
| Coordinates | 4915893..4916000 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 4916048..4916114 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I6H02_RS25380 | 4911737..4912819 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| I6H02_RS25385 | 4912819..4913652 | + | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| I6H02_RS25390 | 4913649..4914041 | + | 393 | WP_000200363.1 | invasion regulator SirB2 | - |
| I6H02_RS25395 | 4914045..4914854 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| I6H02_RS25400 | 4914890..4915744 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| I6H02_RS25405 | 4915893..4916000 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4916048..4916114 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_25 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 4916048..4916114 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 4916050..4916113 | + | 64 | NuclAT_39 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_39 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_39 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_39 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_42 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_42 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_42 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_42 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_45 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_45 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_45 | - | - |
| - | 4916050..4916113 | + | 64 | NuclAT_45 | - | - |
| I6H02_RS25410 | 4916428..4916535 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4916588..4916649 | + | 62 | NuclAT_38 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_38 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_38 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_38 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_41 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_41 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_41 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_41 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_44 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_44 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_44 | - | - |
| - | 4916588..4916649 | + | 62 | NuclAT_44 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_26 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_26 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_26 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_26 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_28 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_28 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_28 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_28 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_30 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_30 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_30 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_30 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_32 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_32 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_32 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_32 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_34 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_34 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_34 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_34 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_36 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_36 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_36 | - | - |
| - | 4916588..4916650 | + | 63 | NuclAT_36 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_14 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_14 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_14 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_14 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_16 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_16 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_16 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_16 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_18 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_18 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_18 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_18 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_20 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_20 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_20 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_20 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_22 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_22 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_22 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_22 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_24 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_24 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_24 | - | - |
| - | 4916588..4916651 | + | 64 | NuclAT_24 | - | - |
| I6H02_RS25415 | 4916964..4917071 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 4917119..4917184 | + | 66 | NuclAT_37 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_37 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_37 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_37 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_40 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_40 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_40 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_40 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_43 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_43 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_43 | - | - |
| - | 4917119..4917184 | + | 66 | NuclAT_43 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_13 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_13 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_13 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_13 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_15 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_15 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_15 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_15 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_17 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_17 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_17 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_17 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_19 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_19 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_19 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_19 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_21 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_21 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_21 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_21 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_23 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_23 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_23 | - | - |
| - | 4917119..4917186 | + | 68 | NuclAT_23 | - | - |
| I6H02_RS25420 | 4917476..4918576 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| I6H02_RS25425 | 4918846..4919076 | + | 231 | WP_001146440.1 | putative cation transport regulator ChaB | - |
| I6H02_RS25430 | 4919234..4919929 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| I6H02_RS25435 | 4919973..4920326 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T182999 WP_000170954.1 NZ_CP065611:c4916000-4915893 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T182999 NZ_CP086625:264075-264182 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 67 bp
>AT182999 NZ_CP065611:4916048-4916114 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|