Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 38702..38907 | Replicon | 1 plasmid p1_55kb |
Accession | NZ_CP065548 | ||
Organism | Enterococcus faecium strain Dallas |
Toxin (Protein)
Gene name | txpA | Uniprot ID | E3USR6 |
Locus tag | I7089_RS14045 | Protein ID | WP_002295624.1 |
Coordinates | 38785..38907 (-) | Length | 41 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 38702..38803 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I7089_RS14015 | 33907..36111 | + | 2205 | WP_025481008.1 | type IA DNA topoisomerase | - |
I7089_RS14020 | 36127..36276 | + | 150 | WP_002295632.1 | hypothetical protein | - |
I7089_RS14025 | 36350..36943 | + | 594 | WP_002287520.1 | transcriptional regulator | - |
I7089_RS14030 | 36959..37858 | + | 900 | WP_002305191.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
I7089_RS14035 | 37861..38346 | + | 486 | WP_002295626.1 | single-stranded DNA-binding protein | - |
I7089_RS14040 | 38368..38625 | + | 258 | WP_002305195.1 | hypothetical protein | - |
- | 38702..38803 | + | 102 | NuclAT_0 | - | Antitoxin |
I7089_RS14045 | 38785..38907 | - | 123 | WP_002295624.1 | putative holin-like toxin | Toxin |
I7089_RS14050 | 39061..39321 | + | 261 | WP_049055261.1 | hypothetical protein | - |
I7089_RS14055 | 39764..39964 | + | 201 | WP_002305199.1 | hypothetical protein | - |
I7089_RS14060 | 39969..40406 | + | 438 | WP_002287515.1 | hypothetical protein | - |
I7089_RS14065 | 40399..41106 | + | 708 | WP_002305202.1 | hypothetical protein | - |
I7089_RS14070 | 41487..41666 | + | 180 | WP_002305204.1 | hypothetical protein | - |
I7089_RS14075 | 42272..42877 | + | 606 | WP_002300095.1 | Fic family protein | - |
I7089_RS14080 | 42893..43468 | + | 576 | WP_002300096.1 | recombinase family protein | - |
I7089_RS14085 | 43628..43831 | + | 204 | WP_002300097.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..55498 | 55498 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 41 a.a. Molecular weight: 4431.42 Da Isoelectric Point: 10.3686
>T182898 WP_002295624.1 NZ_CP065548:c38907-38785 [Enterococcus faecium]
MKGVSLLSAYETIQTILGFGMFTIALISLIVNMLKNDKKK
MKGVSLLSAYETIQTILGFGMFTIALISLIVNMLKNDKKK
Download Length: 123 bp
>T182898 NZ_CP086620:263303-263410 [Escherichia coli]
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAACTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CATGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 102 bp
>AT182898 NZ_CP065548:38702-38803 [Enterococcus faecium]
CCCTCATTAACAGCACCGTTTAAAGAACGGCGGCTCAGATTAATTATTTATTGAGAAATAACCGATCCTCGCTAAAGTGA
CGGTTATTTCTTTTTGTCATTT
CCCTCATTAACAGCACCGTTTAAAGAACGGCGGCTCAGATTAATTATTTATTGAGAAATAACCGATCCTCGCTAAAGTGA
CGGTTATTTCTTTTTGTCATTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|