Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 54613..54866 | Replicon | plasmid pOlaf_02 |
| Accession | NZ_CP065466 | ||
| Organism | Klebsiella pneumoniae strain Olaf | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | I5M57_RS28335 | Protein ID | WP_001312851.1 |
| Coordinates | 54613..54762 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 54807..54866 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I5M57_RS28300 | 49972..50387 | - | 416 | Protein_64 | IS1 family transposase | - |
| I5M57_RS28305 | 50636..51037 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| I5M57_RS28310 | 50970..51227 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| I5M57_RS28315 | 51320..51973 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
| I5M57_RS28320 | 52912..53769 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
| I5M57_RS28325 | 53762..53836 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
| I5M57_RS28330 | 54081..54329 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
| I5M57_RS28335 | 54613..54762 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 54807..54866 | + | 60 | NuclAT_0 | - | Antitoxin |
| - | 54807..54866 | + | 60 | NuclAT_0 | - | Antitoxin |
| - | 54807..54866 | + | 60 | NuclAT_0 | - | Antitoxin |
| - | 54807..54866 | + | 60 | NuclAT_0 | - | Antitoxin |
| I5M57_RS28340 | 55067..55297 | - | 231 | WP_001736714.1 | hypothetical protein | - |
| I5M57_RS28345 | 55461..56060 | - | 600 | WP_032083981.1 | hypothetical protein | - |
| I5M57_RS28350 | 56446..56646 | - | 201 | WP_015059022.1 | hypothetical protein | - |
| I5M57_RS28355 | 56778..57338 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
| I5M57_RS28360 | 57393..58139 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
| I5M57_RS28365 | 58159..58320 | - | 162 | Protein_77 | DNA helicase | - |
| I5M57_RS28370 | 58384..59088 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
| I5M57_RS28375 | 59141..59206 | + | 66 | Protein_79 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / tet(A) | - | 1..105091 | 105091 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T182809 WP_001312851.1 NZ_CP065466:c54762-54613 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T182809 NZ_CP086604:583169-583272 [Escherichia fergusonii]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 60 bp
>AT182809 NZ_CP065466:54807-54866 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|