Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 49396..49649 | Replicon | plasmid pGordon_01 |
Accession | NZ_CP065461 | ||
Organism | Klebsiella pneumoniae strain Gordon |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | I5M58_RS27740 | Protein ID | WP_001312851.1 |
Coordinates | 49396..49545 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 49590..49649 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I5M58_RS27705 | 44755..45170 | - | 416 | Protein_57 | IS1 family transposase | - |
I5M58_RS27710 | 45419..45820 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
I5M58_RS27715 | 45753..46010 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
I5M58_RS27720 | 46103..46756 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
I5M58_RS27725 | 47695..48552 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
I5M58_RS27730 | 48545..48619 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
I5M58_RS27735 | 48864..49112 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
I5M58_RS27740 | 49396..49545 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 49590..49649 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 49590..49649 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 49590..49649 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 49590..49649 | + | 60 | NuclAT_0 | - | Antitoxin |
I5M58_RS27745 | 49850..50080 | - | 231 | WP_001736714.1 | hypothetical protein | - |
I5M58_RS27750 | 50244..50843 | - | 600 | WP_032083981.1 | hypothetical protein | - |
I5M58_RS27755 | 51229..51429 | - | 201 | WP_015059022.1 | hypothetical protein | - |
I5M58_RS27760 | 51561..52121 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
I5M58_RS27765 | 52176..52922 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
I5M58_RS27770 | 52942..53103 | - | 162 | Protein_70 | DNA helicase | - |
I5M58_RS27775 | 53167..53871 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
I5M58_RS27780 | 53924..53989 | + | 66 | Protein_72 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaKPC-2 / blaCTX-M-65 / tet(A) | - | 1..105090 | 105090 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T182783 WP_001312851.1 NZ_CP065461:c49545-49396 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T182783 NZ_CP086572:2371438-2371545 [Staphylococcus argenteus]
ATGTTCAATTTATTGATTAACATCATGACTACAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTGATTAACATCATGACTACAGCTATAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 60 bp
>AT182783 NZ_CP065461:49590-49649 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|