Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 34683..34936 | Replicon | plasmid pMrsPuff_02 |
Accession | NZ_CP065440 | ||
Organism | Klebsiella pneumoniae strain Mrs. Puff |
Toxin (Protein)
Gene name | srnB | Uniprot ID | G9G1E3 |
Locus tag | I5M55_RS28040 | Protein ID | WP_001312851.1 |
Coordinates | 34683..34832 (-) | Length | 50 a.a. |
Antitoxin (RNA)
Gene name | srnC | ||
Locus tag | - | ||
Coordinates | 34877..34936 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I5M55_RS28005 | 30042..30457 | - | 416 | Protein_41 | IS1 family transposase | - |
I5M55_RS28010 | 30706..31107 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
I5M55_RS28015 | 31040..31297 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
I5M55_RS28020 | 31390..32043 | - | 654 | WP_000616807.1 | CPBP family intramembrane metalloprotease | - |
I5M55_RS28025 | 32982..33839 | - | 858 | WP_032495102.1 | incFII family plasmid replication initiator RepA | - |
I5M55_RS28030 | 33832..33906 | - | 75 | WP_001375168.1 | RepA leader peptide Tap | - |
I5M55_RS28035 | 34151..34399 | - | 249 | WP_000083837.1 | replication regulatory protein RepA | - |
I5M55_RS28040 | 34683..34832 | - | 150 | WP_001312851.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
- | 34877..34936 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 34877..34936 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 34877..34936 | + | 60 | NuclAT_0 | - | Antitoxin |
- | 34877..34936 | + | 60 | NuclAT_0 | - | Antitoxin |
I5M55_RS28045 | 35137..35367 | - | 231 | WP_001736714.1 | hypothetical protein | - |
I5M55_RS28050 | 35531..36130 | - | 600 | WP_032083981.1 | hypothetical protein | - |
I5M55_RS28055 | 36516..36716 | - | 201 | WP_015059022.1 | hypothetical protein | - |
I5M55_RS28060 | 36848..37408 | - | 561 | WP_000139328.1 | fertility inhibition protein FinO | - |
I5M55_RS28065 | 37463..38209 | - | 747 | WP_000205770.1 | conjugal transfer pilus acetylase TraX | - |
I5M55_RS28070 | 38229..38390 | - | 162 | Protein_54 | DNA helicase | - |
I5M55_RS28075 | 38454..39158 | + | 705 | WP_001067855.1 | IS6-like element IS26 family transposase | - |
I5M55_RS28080 | 39211..39276 | + | 66 | Protein_56 | helix-turn-helix domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | blaKPC-2 / blaCTX-M-90 | - | 1..89034 | 89034 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T182656 WP_001312851.1 NZ_CP065440:c34832-34683 [Klebsiella pneumoniae]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T182656 NZ_CP086526:2648986-2649093 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 60 bp
>AT182656 NZ_CP065440:34877-34936 [Klebsiella pneumoniae]
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TAAGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|