Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
Location | 1812144..1812324 | Replicon | chromosome |
Accession | NZ_CP065354 | ||
Organism | Staphylococcus aureus strain JW_comp_novo |
Toxin (Protein)
Gene name | sprA1 | Uniprot ID | - |
Locus tag | I5044_RS08550 | Protein ID | WP_001801861.1 |
Coordinates | 1812144..1812239 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | sprA1AS | ||
Locus tag | - | ||
Coordinates | 1812267..1812324 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I5044_RS08510 (I5044_08510) | 1807610..1808605 | + | 996 | WP_020977362.1 | DUF4352 domain-containing protein | - |
I5044_RS08515 (I5044_08515) | 1808681..1809307 | + | 627 | WP_000669045.1 | hypothetical protein | - |
I5044_RS08520 (I5044_08520) | 1809348..1809689 | + | 342 | WP_000627534.1 | DUF3969 family protein | - |
I5044_RS08525 (I5044_08525) | 1809790..1810362 | + | 573 | WP_000414218.1 | hypothetical protein | - |
I5044_RS08530 (I5044_08530) | 1810880..1811056 | - | 177 | WP_000375478.1 | hypothetical protein | - |
I5044_RS08535 (I5044_08535) | 1811067..1811389 | - | 323 | Protein_1682 | hypothetical protein | - |
I5044_RS13435 | 1811416..1811619 | - | 204 | WP_225970890.1 | IS3 family transposase | - |
I5044_RS08545 (I5044_08545) | 1811763..1811999 | - | 237 | WP_000251969.1 | IS3 family transposase | - |
I5044_RS08550 (I5044_08550) | 1812144..1812239 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
- | 1812267..1812324 | - | 58 | - | - | Antitoxin |
I5044_RS13440 | 1812362..1812426 | + | 65 | Protein_1686 | hypothetical protein | - |
I5044_RS08555 (I5044_08555) | 1812455..1812610 | + | 156 | WP_001215823.1 | hypothetical protein | - |
I5044_RS08560 (I5044_08560) | 1813179..1813622 | - | 444 | WP_000728661.1 | DUF1433 domain-containing protein | - |
I5044_RS08565 (I5044_08565) | 1813622..1814065 | - | 444 | WP_000731420.1 | DUF1433 domain-containing protein | - |
I5044_RS08570 (I5044_08570) | 1814065..1814508 | - | 444 | WP_000747798.1 | DUF1433 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1811763..1811999 | 236 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T182454 WP_001801861.1 NZ_CP065354:1812144-1812239 [Staphylococcus aureus]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T182454 NZ_CP086464:c3029450-3029348 [Klebsiella pneumoniae]
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
GCAAGGCGACTTAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATACA
GGAATCGTATTCGGTCTCTTTTT
Antitoxin
Download Length: 58 bp
>AT182454 NZ_CP065354:c1812324-1812267 [Staphylococcus aureus]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|