Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 3531192..3531413 Replicon chromosome
Accession NZ_CP065152
Organism Escherichia coli O150:H6 strain FEX669

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag H7994_RS16995 Protein ID WP_000170963.1
Coordinates 3531192..3531299 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 3531347..3531413 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
H7994_RS16970 3527036..3528118 + 1083 WP_000804726.1 peptide chain release factor 1 -
H7994_RS16975 3528118..3528951 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
H7994_RS16980 3528948..3529340 + 393 WP_000200375.1 invasion regulator SirB2 -
H7994_RS16985 3529344..3530153 + 810 WP_001257054.1 invasion regulator SirB1 -
H7994_RS16990 3530189..3531043 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
H7994_RS16995 3531192..3531299 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 3531347..3531413 + 67 NuclAT_10 - Antitoxin
- 3531347..3531413 + 67 NuclAT_10 - Antitoxin
- 3531347..3531413 + 67 NuclAT_10 - Antitoxin
- 3531347..3531413 + 67 NuclAT_10 - Antitoxin
- 3531347..3531413 + 67 NuclAT_11 - Antitoxin
- 3531347..3531413 + 67 NuclAT_11 - Antitoxin
- 3531347..3531413 + 67 NuclAT_11 - Antitoxin
- 3531347..3531413 + 67 NuclAT_11 - Antitoxin
- 3531347..3531413 + 67 NuclAT_6 - Antitoxin
- 3531347..3531413 + 67 NuclAT_6 - Antitoxin
- 3531347..3531413 + 67 NuclAT_6 - Antitoxin
- 3531347..3531413 + 67 NuclAT_6 - Antitoxin
- 3531347..3531413 + 67 NuclAT_7 - Antitoxin
- 3531347..3531413 + 67 NuclAT_7 - Antitoxin
- 3531347..3531413 + 67 NuclAT_7 - Antitoxin
- 3531347..3531413 + 67 NuclAT_7 - Antitoxin
- 3531347..3531413 + 67 NuclAT_8 - Antitoxin
- 3531347..3531413 + 67 NuclAT_8 - Antitoxin
- 3531347..3531413 + 67 NuclAT_8 - Antitoxin
- 3531347..3531413 + 67 NuclAT_8 - Antitoxin
- 3531347..3531413 + 67 NuclAT_9 - Antitoxin
- 3531347..3531413 + 67 NuclAT_9 - Antitoxin
- 3531347..3531413 + 67 NuclAT_9 - Antitoxin
- 3531347..3531413 + 67 NuclAT_9 - Antitoxin
- 3531349..3531412 + 64 NuclAT_14 - -
- 3531349..3531412 + 64 NuclAT_14 - -
- 3531349..3531412 + 64 NuclAT_14 - -
- 3531349..3531412 + 64 NuclAT_14 - -
- 3531349..3531412 + 64 NuclAT_15 - -
- 3531349..3531412 + 64 NuclAT_15 - -
- 3531349..3531412 + 64 NuclAT_15 - -
- 3531349..3531412 + 64 NuclAT_15 - -
- 3531349..3531412 + 64 NuclAT_16 - -
- 3531349..3531412 + 64 NuclAT_16 - -
- 3531349..3531412 + 64 NuclAT_16 - -
- 3531349..3531412 + 64 NuclAT_16 - -
- 3531349..3531412 + 64 NuclAT_17 - -
- 3531349..3531412 + 64 NuclAT_17 - -
- 3531349..3531412 + 64 NuclAT_17 - -
- 3531349..3531412 + 64 NuclAT_17 - -
- 3531349..3531412 + 64 NuclAT_18 - -
- 3531349..3531412 + 64 NuclAT_18 - -
- 3531349..3531412 + 64 NuclAT_18 - -
- 3531349..3531412 + 64 NuclAT_18 - -
- 3531349..3531412 + 64 NuclAT_19 - -
- 3531349..3531412 + 64 NuclAT_19 - -
- 3531349..3531412 + 64 NuclAT_19 - -
- 3531349..3531412 + 64 NuclAT_19 - -
- 3531349..3531414 + 66 NuclAT_21 - -
- 3531349..3531414 + 66 NuclAT_21 - -
- 3531349..3531414 + 66 NuclAT_21 - -
- 3531349..3531414 + 66 NuclAT_21 - -
- 3531349..3531414 + 66 NuclAT_22 - -
- 3531349..3531414 + 66 NuclAT_22 - -
- 3531349..3531414 + 66 NuclAT_22 - -
- 3531349..3531414 + 66 NuclAT_22 - -
- 3531349..3531414 + 66 NuclAT_23 - -
- 3531349..3531414 + 66 NuclAT_23 - -
- 3531349..3531414 + 66 NuclAT_23 - -
- 3531349..3531414 + 66 NuclAT_23 - -
- 3531349..3531414 + 66 NuclAT_24 - -
- 3531349..3531414 + 66 NuclAT_24 - -
- 3531349..3531414 + 66 NuclAT_24 - -
- 3531349..3531414 + 66 NuclAT_24 - -
H7994_RS17000 3531704..3532804 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
H7994_RS17005 3533074..3533304 + 231 WP_001146444.1 putative cation transport regulator ChaB -
H7994_RS17010 3533462..3534157 + 696 WP_000632706.1 glutathione-specific gamma-glutamylcyclotransferase -
H7994_RS17015 3534201..3534554 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
H7994_RS17020 3534739..3536133 + 1395 WP_000086194.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T182150 WP_000170963.1 NZ_CP065152:c3531299-3531192 [Escherichia coli O150:H6]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T182150 NZ_CP086336:502972-503259 [Escherichia coli]
ATGCCAATGGAGTTTGAATGGGATGAAAACAAGGCCAAAAGTAATCGGGTGAAACATGGCATCCGCTTTGAAGATGCGGT
GTTATTGTTTGATGATCCACAACATTTGTCACAGCAAGAACGCATAGAAAACGGTGAGTATCGCTGGCAGACAATCGGCC
TGGTTTACGGCATCGTGGTTATTCTGGTTGCGCATACCATCCGTTTCGAAAGCGGAAATGAAATTATTCGAATCATCAGT
GCACGAAAAGCAGATCGTAAAGAGAGGAATCGCTATGAGCATGGTTAA

Antitoxin


Download         Length: 67 bp

>AT182150 NZ_CP065152:3531347-3531413 [Escherichia coli O150:H6]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References